KEGG   Magnetospirillum gryphiswaldense: MGMSRv2__1838Help
Entry
MGMSRv2__1838     CDS       T02960                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase containing thiolase domain (Acetoacetyl-CoA thiolase)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mgy  Magnetospirillum gryphiswaldense
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mgy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGMSRv2__1838 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MGMSRv2__1838 (phbA)
   00640 Propanoate metabolism
    MGMSRv2__1838 (phbA)
   00650 Butanoate metabolism
    MGMSRv2__1838 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    MGMSRv2__1838 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MGMSRv2__1838 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGMSRv2__1838 (phbA)
   00310 Lysine degradation
    MGMSRv2__1838 (phbA)
   00380 Tryptophan metabolism
    MGMSRv2__1838 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MGMSRv2__1838 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MGMSRv2__1838 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MGMSRv2__1838 (phbA)
Enzymes [BR:mgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MGMSRv2__1838 (phbA)
Exosome [BR:mgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGMSRv2__1838 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1937093..1938265)
Genome map
AA seq 390 aa AA seqDB search
MTDIVIVSAARTPVGSFSGSLSGYQAAQLGEIVIREVLSRANVAADDVSEVLMGHILSAG
NGMNTARQAALKAGLPIGSTAMTINQVCGSGLRAVALGMQAILAGDSKVVVAGGHESMSN
SQHAGYLRSGIKMGPMGFVDTMINDGLTDVFNAYHMGVTAENVAKEYGITREEQDEFAVA
SQNKAEAAVKSGRFKDEIVPVKIVVKKEEKLFDTDEYIRSGATVEAMAKLKPAFDKAGTV
TAGNASGINDGAAAVLLMTAEEAAKRGLKPLATIKSWATAGVDPKVMGIGPVPASKLALE
KAGWTHEQLDLIEANEAFASQAIAVNKGMGWDTSKVNVNGGAIAIGHPIGASGCRVLVSL
IHEMIKRDAKKGLATLCIGGGMGIAMCIER
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgttatcgtttccgccgcccgtacccccgtgggctcgttcagcggttcc
ctttccggctatcaggctgcgcagctgggcgagatcgtcatccgcgaagtcctgtcccgc
gccaatgtcgccgccgacgacgtgtcggaagtgctgatgggacacatcctgtccgccggc
aacggcatgaacaccgcccgtcaggcggcgttgaaggccggcctgcccatcggttccacc
gccatgaccatcaatcaggtctgcggttccggcctgcgcgccgtcgccttgggcatgcag
gccatcctggccggcgattccaaggtggtggtggccggcggccatgaaagcatgagcaac
tcgcagcacgccggatacttgcgcagcggcatcaagatggggccgatgggcttcgtcgat
accatgatcaatgacggtctgaccgacgtgttcaacgcctatcacatgggcgtcaccgcc
gagaacgtggccaaggaatacggtatcacccgcgaagagcaggacgaattcgccgtcgct
tcccagaacaaggccgaagccgccgtcaagtcgggccgtttcaaggacgaaatcgtcccg
gtcaagatcgtggtgaagaaggaagaaaagctgttcgacaccgacgaatacatccgttcg
ggcgccaccgtcgaagccatggccaagctgaagcccgccttcgacaaggccggcaccgtc
accgccggcaatgcctcgggcatcaatgacggcgcggcggcggtgctgctgatgaccgcc
gaagaagcggccaagcgcggtctcaagcccttggccacgatcaagagctgggctaccgcc
ggtgtcgaccccaaggtcatgggcatcggcccggtgccggcgtccaagctggccctggaa
aaggccggctggacccatgaacagctcgacctgatcgaagccaacgaagccttcgcctcc
caggccatcgccgtcaacaagggcatgggctgggataccagcaaggtcaacgtcaatggc
ggcgccatcgccatcggtcaccccatcggcgcctcgggctgccgcgtcctggtgtcgttg
atccatgaaatgatcaagcgcgacgccaagaagggcctggccaccttgtgcatcggtggc
ggcatgggcatcgccatgtgcatcgagcggtaa

DBGET integrated database retrieval system