KEGG   Mycoplasma haemofelis Langford 1: HF1_15010Help
Entry
HF1_15010         CDS       T01418                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mha  Mycoplasma haemofelis Langford 1
Pathway
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1098158..1099555)
Genome map
AA seq 465 aa AA seqDB search
MSGYILAIDASSSSCKAALVDDHGRVVREHSLPVGTQYLSDFHVEQDPEEIFKSQVRVMK
EVLVGIDPILVKGIGISNQRETVVAWDPETGLPLYPAISWQDRRNLDFFQDLKPHEDFIR
KTTGLVFHPYFSASKVKWLLSHLQGQHFKIGTIDSWLIFKLTGHQVFATDVSNASRTMLM
DIEKLCWSEELLELFQISEDILPQIKNSLDDYGSWEYRGVKIPILGVLGDQQAALFSLGT
EEGTACCTYGTGAFLLVNCGIERKTIPNTLTTVSWKLDEGETSYAIESSLFSCGNAMKQF
EKKGSIGNYEMSTQTYLDSFLLPAFNGNLFLMDSKEYQDLSHNEDAVLGDPENLLKSLCN
GIALAVDHMLSLFREDIDIKELWVNGRVSDLEYLNSVQSSICGLNVMKCSQENQSIMGIA
YLVGIGVNFWELKDLQNMRAFRRVWLPQEINPIIKDLKRSWKKAL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
gtgtctggttatattcttgccatagatgctagttcttcatcctgtaaggccgctttagtt
gatgatcatgggagagtagttagagaacactctcttcctgtaggcactcaatatttgagt
gactttcatgtggagcaagatccggaggagatttttaagtctcaggttcgggtcatgaaa
gaggttcttgtcggaattgatcctatcctagtaaagggcataggaatttctaatcagagg
gagactgttgtagcgtgagatcccgaaacaggactccctctttatcctgctatttcttgg
caggatagaaggaatttagatttctttcaagatctaaagccccatgaagatttcattagg
aaaacaactggattagttttccacccctatttctccgcttccaaagtaaagtgattgctt
agtcatttgcaaggacagcacttcaagattggaactatagatagctgactgatatttaaa
ttaactggccatcaagtatttgccacagatgtgagcaatgcttccagaactatgcttatg
gatatagagaagttatgttgatctgaagagctgcttgagttgtttcaaatttccgaagat
atacttccccaaataaagaactctttggacgactatggatcttgggaatataggggagta
aagatccccattcttggggttttaggggatcaacaagccgctttattttccttagggaca
gaagaaggaacagcttgttgcacctatggaacgggagctttcctattggttaattgcggt
atcgaaagaaagacgattcctaataccttaactacggtttcttggaagttggatgaagga
gagacctcctatgccatagagtcttcccttttcagttgcggaaacgctatgaagcaattt
gaaaagaaggggtctattggaaattacgaaatgtctactcagacctatttagattccttc
ttgctaccggcatttaacgggaacttattcctaatggattccaaagagtatcaagacttg
tctcacaatgaggatgcagttctcggggatcccgagaatcttctaaagtccttgtgcaat
ggtattgccttagctgtagatcatatgctttccttatttagggaagatattgatatcaag
gaactttgggttaatgggagggtatctgatttggaatatttaaattcagttcagtcttct
atatgtggcctaaacgttatgaagtgtagccaagagaatcagagtattatggggattgct
tatttagtaggaataggagttaacttttgagaactaaaggatttgcagaatatgagggct
ttcagaagggtttgattaccccaagaaattaatccaattattaaggatttgaaacgaagt
tgaaaaaaagctttataa

DBGET integrated database retrieval system