KEGG   Mycoplasma haemofelis Langford 1: HF1_15220Help
Entry
HF1_15220         CDS       T01418                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mha  Mycoplasma haemofelis Langford 1
Pathway
mha00010  Glycolysis / Gluconeogenesis
mha00051  Fructose and mannose metabolism
mha01100  Metabolic pathways
mha01110  Biosynthesis of secondary metabolites
mha01120  Microbial metabolism in diverse environments
mha01130  Biosynthesis of antibiotics
mha01200  Carbon metabolism
mha01230  Biosynthesis of amino acids
Module
mha_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HF1_15220 (tpiA)
   00051 Fructose and mannose metabolism
    HF1_15220 (tpiA)
   00562 Inositol phosphate metabolism
    HF1_15220 (tpiA)
Enzymes [BR:mha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HF1_15220 (tpiA)
Exosome [BR:mha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HF1_15220 (tpiA)
  Exosomal proteins of bladder cancer cells
   HF1_15220 (tpiA)
  Exosomal proteins of melanoma cells
   HF1_15220 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CBY93530
UniProt: E8ZK59
Position
complement(1121706..1122413)
Genome map
AA seq 235 aa AA seqDB search
MKIVFGNLKMNFLYKDFQDYIENLRMKFLGETPKVHLGLAIPYIYLKSASESIGSKIKVL
AQDLHPVDFGAFTSSVSAAQLASLNVPATLIGHSECRQLSQNSFVISNKIKSALRNGLEI
IYCCGEDPEKEISEELFFMTEEEISKVIIAYEPISSIGTGQAMDPSGADSTLLKIRDLIA
DKYGRKVADSMKLLYGGSVNLSNYKGYLEKKNIDGVLVGGASLKVDDLWKMATLE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagtatttggaaacctgaagatgaacttcctgtacaaggattttcaggattat
attgagaatctaagaatgaagttcttaggcgagactcctaaggtacatcttgggttagct
attccttacatatatctgaagagtgcttctgagtcaattggatccaagattaaagtgtta
gctcaagaccttcatcctgttgattttggtgcttttacgtcctctgtttctgcggctcaa
cttgcttctcttaatgttcctgcgacattgattggacattctgaatgtagacagctaagt
cagaattcctttgttatctctaacaagataaagtctgctttgagaaatggattggagatt
atctattgctgcggggaggatcccgagaaggaaatatctgaagagctattcttcatgacc
gaggaggagataagtaaggtgataattgcttatgaacctatttcttcaatagggactggg
caagctatggatcctagtggggctgattctactcttcttaagataagagatttaatagct
gataagtatggaaggaaggtagctgactctatgaagttattgtatggtggttctgttaat
ttgtctaactataaagggtacctagagaagaagaatatagatggagttttggttggtggg
gcttccttgaaggttgatgatctttgaaaaatggcaactttagaataa

DBGET integrated database retrieval system