KEGG   Mycoplasma haemofelis Langford 1: HF1_15220Help
Entry
HF1_15220         CDS       T01418                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mha  Mycoplasma haemofelis Langford 1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mha00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HF1_15220 (tpiA)
   01230 Biosynthesis of amino acids
    HF1_15220 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HF1_15220 (tpiA)
   00051 Fructose and mannose metabolism
    HF1_15220 (tpiA)
   00562 Inositol phosphate metabolism
    HF1_15220 (tpiA)
Enzymes [BR:mha01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HF1_15220 (tpiA)
Exosome [BR:mha04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HF1_15220 (tpiA)
  Exosomal proteins of bladder cancer cells
   HF1_15220 (tpiA)
  Exosomal proteins of melanoma cells
   HF1_15220 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(1121706..1122413)
Genome map
AA seq 235 aa AA seqDB search
MKIVFGNLKMNFLYKDFQDYIENLRMKFLGETPKVHLGLAIPYIYLKSASESIGSKIKVL
AQDLHPVDFGAFTSSVSAAQLASLNVPATLIGHSECRQLSQNSFVISNKIKSALRNGLEI
IYCCGEDPEKEISEELFFMTEEEISKVIIAYEPISSIGTGQAMDPSGADSTLLKIRDLIA
DKYGRKVADSMKLLYGGSVNLSNYKGYLEKKNIDGVLVGGASLKVDDLWKMATLE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagtatttggaaacctgaagatgaacttcctgtacaaggattttcaggattat
attgagaatctaagaatgaagttcttaggcgagactcctaaggtacatcttgggttagct
attccttacatatatctgaagagtgcttctgagtcaattggatccaagattaaagtgtta
gctcaagaccttcatcctgttgattttggtgcttttacgtcctctgtttctgcggctcaa
cttgcttctcttaatgttcctgcgacattgattggacattctgaatgtagacagctaagt
cagaattcctttgttatctctaacaagataaagtctgctttgagaaatggattggagatt
atctattgctgcggggaggatcccgagaaggaaatatctgaagagctattcttcatgacc
gaggaggagataagtaaggtgataattgcttatgaacctatttcttcaatagggactggg
caagctatggatcctagtggggctgattctactcttcttaagataagagatttaatagct
gataagtatggaaggaaggtagctgactctatgaagttattgtatggtggttctgttaat
ttgtctaactataaagggtacctagagaagaagaatatagatggagttttggttggtggg
gcttccttgaaggttgatgatctttgaaaaatggcaactttagaataa

DBGET integrated database retrieval system