KEGG   Mycobacterium haemophilum: B586_11645Help
Entry
B586_11645        CDS       T04111                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mhad  Mycobacterium haemophilum
Pathway
mhad00071  Fatty acid degradation
mhad00072  Synthesis and degradation of ketone bodies
mhad00280  Valine, leucine and isoleucine degradation
mhad00310  Lysine degradation
mhad00362  Benzoate degradation
mhad00380  Tryptophan metabolism
mhad00620  Pyruvate metabolism
mhad00630  Glyoxylate and dicarboxylate metabolism
mhad00640  Propanoate metabolism
mhad00650  Butanoate metabolism
mhad00900  Terpenoid backbone biosynthesis
mhad01100  Metabolic pathways
mhad01110  Biosynthesis of secondary metabolites
mhad01120  Microbial metabolism in diverse environments
mhad01130  Biosynthesis of antibiotics
mhad01200  Carbon metabolism
mhad01212  Fatty acid metabolism
mhad02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mhad00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B586_11645
   00630 Glyoxylate and dicarboxylate metabolism
    B586_11645
   00640 Propanoate metabolism
    B586_11645
   00650 Butanoate metabolism
    B586_11645
  Lipid metabolism
   00071 Fatty acid degradation
    B586_11645
   00072 Synthesis and degradation of ketone bodies
    B586_11645
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B586_11645
   00310 Lysine degradation
    B586_11645
   00380 Tryptophan metabolism
    B586_11645
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B586_11645
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B586_11645
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B586_11645
Enzymes [BR:mhad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B586_11645
Exosome [BR:mhad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B586_11645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AKN17056
Position
2277141..2278628
Genome map
AA seq 495 aa AA seqDB search
MPADPRTPVLVGYGQINHRDEINPNTRSVEPVDLMAAAARQAANSRVLEAVDSIRVVNVL
SARYRDPGLLLGMRIGAADFATLYSPIGGNVPQSLVNQACLDIQQGRAGVVLLAGAETWR
TRMALRAQGGKLAWTVQDESVPMAEVTGDDVAMFGDAEIRIQLDRPAYVYPLFEQALRIA
NGASIEEHGRRVGELWARFNAVAVDNPYAWIRQPVTAEQITRSGPQNRMISWPYTKLMNS
NNMVDQGAALILTSVELATRLQIPAERWVYPHAGTAAHDTAAIAERAELNRSAAIRIAGA
RVLELAGIDDIGDIDYVDLYSCFPSAVQVAAAELGLSLDDPGRPLTVTGGLTFAGGPWSN
YVMHSIATMAELLVDNPGRRGLITANGGYLTKHSFGVYSTEPPAEFRWEDVQSAVDREPT
RDGPLKWEGVGTVEAWTTPFNRDGQPEKAFLAVRTPDGSRALAVIADPVAAEITVCEDIG
GAKVTVAADGSATLK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgaccccagaacaccggtgctggtcggctatggccagatcaaccaccgcgac
gaaatcaacccgaacacacggtccgtcgaaccggtcgacctgatggctgccgcggcccgg
caagcagcgaattcccgagtgctggaagccgtggactccattcgcgtggtcaacgtgttg
tcggcacgctaccgagatcccgggctgctgctcgggatgcggatcggtgccgctgacttc
gcaacgctttatagcccgatcggcggcaatgtgccgcagtcgctggtcaaccaggcgtgc
ctggacatccagcagggccgggccggcgtggtgctgcttgccggtgcggaaacctggcgt
accaggatggcgttgcgagcccagggcggcaaactcgcctggacagttcaggacgaatct
gtgccgatggccgaggtgaccggcgatgacgtggcgatgttcggtgacgccgagatcagg
atccagctggatcggccggcgtacgtgtacccgctgttcgagcaggcgcttcgaatcgct
aacggcgcgtcaatcgaggagcacggccgccgcgtgggggaactatgggcacgtttcaac
gccgtcgcggtcgacaatccctacgcgtggatccgtcaaccagtaaccgccgagcagatc
acacgttctggcccgcagaatcggatgatcagctggccctacaccaagttgatgaactcc
aacaacatggtcgatcaaggcgccgcgctgatcctcacctcggttgagttggcgacacgt
ctgcagatccccgccgaacgctgggtgtacccgcacgccggcaccgctgcgcacgacacc
gccgctatcgccgagcgcgccgagttgaatcggtctgcggccatccggatcgccggcgct
cgggtactagagctggccggaattgacgatatcggcgacattgactatgtcgacctgtac
tcgtgttttccctccgccgttcaggtcgcggcggccgaacttggtttgagcctcgacgat
cccggccgcccgctcacagtcactggcgggctgacgtttgcgggcggcccgtggagcaac
tacgtcatgcattccatcgccaccatggctgaacttctggtggacaatcccggacggcgc
ggtctgatcaccgccaacgggggatacctgaccaagcacagcttcggggtctacagcacc
gaaccgccggccgagttccgttgggaagatgtgcagtcggcagtggatcgagagcccacc
cgagacgggccgctcaagtgggaaggtgtcggtactgtcgaagcgtggacgacgccgttc
aaccgtgatggacaaccggagaaagccttcctcgcggtgcgcacgcccgacggctcgcgt
gctttagccgtgatcgccgatcccgtcgcggctgagataacggtgtgtgaagacatcggc
ggcgccaaggttaccgtcgccgccgacggaagcgcgacgctgaagtag

DBGET integrated database retrieval system