KEGG   Mannheimia haemolytica D153: F382_02335Help
Entry
F382_02335        CDS       T02746                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mhae  Mannheimia haemolytica D153
Brite
Enzymes [BR:mhae01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     F382_02335
Secretion system [BR:mhae02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   F382_02335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(446252..446935)
Genome map
AA seq 227 aa AA seqDB search
MKKNLITLGLMCLSTITFASDAKLKSQLEKIGATDVKISDSPLTGFKMATSNEGVVYISQ
DGRYVIQGKVFELKNGKAIDITNQGLLAELNSYTNEMIVYPAKNEKHVITVFMDITCHYC
HLLHTKIKEYNDLGITIRYLAFPRGGMNTQTAKQMEAIWTSADKVKALNDAEDGKLPTQI
KTPDIVKKHYQLGIKFGVTGTPNMVTSEGELIGGYVEPKELAKMLSE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatctaatcactttaggattaatgtgtttatcaaccatcacgtttgcttca
gatgcaaaactaaaaagccagcttgaaaaaattggagccacagatgttaaaatttcagat
tctccattaacaggctttaaaatggcgacttcaaatgaaggtgttgtatatatcagccaa
gacggtcgttatgtaattcaaggtaaagtatttgagctaaaaaatggtaaagcgattgat
attactaatcaaggattgttggcagaattgaattcatacactaatgaaatgatcgtatat
ccagcgaaaaatgagaaacatgtgattacggtgtttatggatattacttgccattattgc
catttactacatactaaaatcaaagaatataatgatttaggtattaccattcgctatttg
gcattcccgcgtggtggaatgaatacccaaacagcaaaacaaatggaagctatttggaca
tcagcagacaaagtaaaagcactgaatgatgctgaagatggtaaattaccaacccaaata
aaaacgccggatattgtgaaaaaacattaccaattagggattaaatttggtgtgacaggt
accccaaatatggtaacttcagaaggtgagttgattggtggttatgtagagcctaaagaa
ttagcgaaaatgttaagtgagtaa

DBGET integrated database retrieval system