KEGG   Mannheimia haemolytica D153: F382_03845Help
Entry
F382_03845        CDS       T02746                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
mhae  Mannheimia haemolytica D153
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mhae00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    F382_03845
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F382_03845
   00620 Pyruvate metabolism
    F382_03845
   00650 Butanoate metabolism
    F382_03845
  Lipid metabolism
   00071 Fatty acid degradation
    F382_03845
  Amino acid metabolism
   00350 Tyrosine metabolism
    F382_03845
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    F382_03845
   00626 Naphthalene degradation
    F382_03845
Enzymes [BR:mhae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     F382_03845
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     F382_03845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
730597..733206
Genome map
AA seq 869 aa AA seqDB search
MAKNTQPFDAQAEVNELVEKGLKALDEFRKLNQEQVDFIVAKASVAALDKHGILAMHAYE
ETGRGVFEDKATKNLFACEYVVNNMRHLKTAGVISEDDVTGITEIADPVGVVCGITPTTN
PTSTTIFKALIALKTRNPIVFAFHPSAQQSSAHAAQIVRDAAVAAGAPENCIQWITQPSM
EGTSALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKTAKLKQAVYDIV
MSKSFDNGMICASEQAAIVDKEIYAEFIKEMQSYGVYLVNKKEKALLEKYIFGIDKAKDE
NCSGAKLNSAVVGKPAAWIAEQAGFKVPEKTNILLAECAFVGEAEPLTREKLSPVLALLK
SDSTEHGLELSEAMVNFHGLGHSAAIHTENKALAKTFGERVKAIRVIWNSPSTFGGIGDV
YNSFLPSLTLGCGSYGKNSVGNNVSAVNLINIKRVGRRRNNMQWFKVPSKIYFERDSIQY
LKSMHDVHKVMIVTDRSMVDLGFVDRITEQLRQRRNQVMIQFFTDVEPNPSLQTVQRGTE
LMRSFQPDTIIALGGGSPMDAAKIMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRKA
KFVGIPTTSGTGSEVTPFAVITDGDIKYPLADYSLTPTIAIVDPALVMSVPSHVAADTGL
DVLTHATEAYTSILANDYTDGLALQAIKLVFENLEKSVKEFDETAREKMHNASTMAGMAF
ANAFLGICHSMAHKIGGKFHTIHGRTNAILLPHVIRYNGTRPTKVATWPKYTNYVADVRF
QDIARMLGLPAETPEQAVEAYAQAVHDLAVRCGVKMSLREQGVDEQAFLNARRELALHAF
EDQCTPANPRLAMIEDMEAIMTKAYYGKE
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaatacgcaaccatttgatgcccaagcagaagtgaatgagcttgttgaaaaa
ggcttaaaagcccttgatgagtttagaaaactcaaccaagaacaagtggattttattgtc
gctaaagcctctgttgctgcccttgataaacacggtattttagcaatgcacgcttacgaa
gaaaccggacggggtgtgtttgaagacaaagccactaaaaacctgttcgcctgtgagtat
gttgtcaataatatgcgacatttgaaaaccgcaggggtcattagtgaagatgatgtcacc
ggtattaccgaaattgccgaccctgtcggtgttgtctgcggtatcaccccaaccaccaac
ccaacctcaaccaccattttcaaagcgttaatcgcccttaaaacccgtaaccctatcgtt
tttgctttccacccgtctgctcaacaatcttctgcccacgctgctcaaattgtgcgtgat
gctgccgtggctgccggtgcaccggaaaactgtattcaatggattacccagccttcaatg
gaaggtacatctgctttaatgaaacacccgggcattgcaactattttagccaccggcggt
aatgcaatggttgaagccgcttactcttgcggcaaaccggcattaggagttggtgcaggc
aacgtaccggcttatgtagaaaaaaccgctaaattaaaacaagcggtgtatgacattgta
atgtcaaaatctttcgacaacggtatgatttgtgcctctgaacaagcggcgattgtagat
aaagaaatttacgctgagtttattaaagagatgcaatcttacggcgtctatttagtgaac
aaaaaagagaaagccttattggaaaaatacattttcggtattgataaagccaaagatgaa
aactgctcaggtgcaaaactcaattcagcggtggttggcaaaccggctgcgtggattgca
gaacaagccggctttaaagtaccggaaaaaaccaatattctgttagccgaatgtgccttt
gtgggcgaagctgagccacttacccgtgaaaaactttcgcctgtactggctctgttaaaa
tccgactccaccgaacacggtttggaattgtctgaagcgatggtgaatttccacggttta
gggcatagtgccgccattcataccgaaaacaaagccttagccaaaacctttggcgaacgg
gtaaaagccattcgggtgatttggaactcaccatcaacctttggcggtatcggtgatgta
tataactccttcctgccatcgcttacgctgggctgtggttcctacggtaaaaactctgta
ggtaacaacgttagtgcggtgaatttaatcaatatcaaacgtgtgggcagacggagaaat
aatatgcaatggtttaaagtgccatcaaaaatctactttgagcgtgactcaattcaatat
ttgaaatcaatgcacgatgtgcataaagtaatgatcgtaaccgaccgctcaatggttgat
ctcggctttgtggatagaattaccgaacaacttcgccaacgtcgcaaccaagtgatgatt
cagttctttaccgatgttgaaccaaacccaagcctgcaaaccgtacaacgtggtacagaa
ttaatgcgtagcttccagcctgatactatcatcgcacttggtggtggttcaccaatggat
gcagccaaaattatgtggttattctacgaacaaccggaagtcgatttccgtgatttagtg
caaaaatttatggatatccgcaaacgtgcattcaaattcccacaattaggcagaaaagcg
aaatttgtcggcattccaaccacctccggaacaggctctgaagtcacaccgtttgcagta
attaccgatggcgatattaaatatccgctcgctgactactcgcttaccccaaccattgcg
attgtcgatcctgcgttagtaatgtctgtgccgtctcacgttgctgccgacaccggttta
gacgtattaactcacgctaccgaggcttacacatcgattttagccaacgactataccgac
ggcttagccttgcaagccattaagttagtgtttgaaaacttggaaaaatcggtcaaagag
tttgatgaaaccgcccgtgaaaaaatgcacaatgcttccacaatggcagggatggcattt
gccaatgccttcttaggtatttgccactcaatggcacacaaaatcgggggtaaattccac
accatccacggtcgaaccaatgcgattttactgccacacgttattcgctataacggcaca
cgcccaaccaaagtggcaacttggccaaaatacaccaattatgtcgcagatgtgcgtttc
caagatattgccagaatgcttggcttaccggcagaaaccccggaacaagcggtggaagct
tacgcccaagcggtacacgatttagccgttcgttgcggcgtgaaaatgtcgcttcgtgag
caaggcgttgatgagcaagccttcttgaatgcccgccgtgaacttgccctacacgcattt
gaagaccaatgcacaccagcaaacccacgtttggcaatgattgaagatatggaagcgatt
atgactaaagcctactatggcaaggaataa

DBGET integrated database retrieval system