KEGG   Mannheimia haemolytica D153: F382_04115Help
Entry
F382_04115        CDS       T02746                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mhae  Mannheimia haemolytica D153
Pathway
mhae00220  Arginine biosynthesis
mhae00250  Alanine, aspartate and glutamate metabolism
mhae00290  Valine, leucine and isoleucine biosynthesis
mhae01100  Metabolic pathways
mhae01110  Biosynthesis of secondary metabolites
mhae01130  Biosynthesis of antibiotics
mhae01210  2-Oxocarboxylic acid metabolism
mhae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F382_04115
   00290 Valine, leucine and isoleucine biosynthesis
    F382_04115
   00220 Arginine biosynthesis
    F382_04115
Enzymes [BR:mhae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     F382_04115
    2.6.1.66  valine---pyruvate transaminase
     F382_04115
Amino acid related enzymes [BR:mhae01007]
 Aminotransferase (transaminase)
  Class I
   F382_04115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGQ25188
Position
complement(790829..792046)
Genome map
AA seq 405 aa AA seqDB search
MDRFPKSDKLAQVRYDIRGPIHKEALRLEEEGHKILKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIVQYYQSKGMRGMDVNDVYIGNGVSELITMSMQALLNDGD
EILIPMPDYPLWTAASTLAGGKAVHYLCDEENEWFPDLEDIKSKITPRTKGILVINPNNP
TGAVYSRQILLEIAELARQHNLIIFADEIYEKIVYDGAVHHHIAALAPDVLTVTYNGLSK
AYRVAGFRQGWMVLSGPKHQAKGFIEGLDMLSSMRLCANTPMQHAIQTALGGYQSINEFV
LPGGRLLEQRNKMHELLVQIPGISCVKAKGALYMFPKIDTEMYGIKDDQKFIYDLLRQEK
VLLVQGSGFNWKKPDHFRVVTLPYAHQIEEAIGRLANFLKTYRQD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttttcccaaatcagataagttagctcaggttcgttacgatatccgtgggcca
attcataaagaggcacttcgcttagaagaagaagggcataaaattttaaaattaaatatc
ggtaacccagccccttttggctttgaagcacccgatgaaattttagtggatgtgattcgt
aatcttccaaccgcacaaggctattgtgattcaaaaggtttgtattctgcccgcaaagcg
attgtgcaatattatcaatcaaaaggtatgcgtggtatggatgtaaacgatgtttacatc
ggcaacggcgtatctgaactgattacaatgtcgatgcaggcgttattaaatgatggcgat
gaaattctaattccaatgcctgattatccgttatggacagcagcttcaaccctagccggt
ggtaaagcagtgcattacctgtgcgatgaagaaaatgagtggttccctgatcttgaagat
attaaatcgaaaatcacgcctcgcactaaagggattttggttatcaacccgaataacccg
accggagcagtgtatagccgtcaaattttgctggaaattgcagaacttgcccgtcagcat
aacttaattatttttgctgacgaaatttatgaaaaaattgtctatgatggtgcggtacat
caccatattgctgctcttgcaccggacgtattaaccgtaacttataacggtttatccaag
gcgtatcgtgttgccggtttccgtcagggctggatggtgctgagcggtccgaagcatcaa
gccaaaggttttattgaagggttggatatgctctcttctatgcgtttatgtgccaatacg
ccgatgcaacacgccattcaaaccgcattaggtggttatcaaagtatcaatgaatttgtg
ttgccgggcggtcgtttgctggaacaacgaaataaaatgcacgaattattggtacaaatt
ccgggtattagctgtgtaaaagcgaaaggggcgttatatatgttcccgaaaattgatacc
gaaatgtacggcattaaagatgaccaaaaattcatctacgatttgttgcgacaagaaaaa
gtgctattagtgcaaggttccggttttaactggaaaaaaccggatcacttccgtgtggta
actttgccttatgcacatcaaattgaagaagcgattggtcgccttgcgaatttcttgaaa
acctatcgtcaagactaa

DBGET integrated database retrieval system