KEGG   Mannheimia haemolytica D153: F382_04680Help
Entry
F382_04680        CDS       T02746                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mhae  Mannheimia haemolytica D153
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhae00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
916225..918303
Genome map
AA seq 692 aa AA seqDB search
MKITAKQYYRAGIMPYFFDERGVKKTASEKIKHSLFKAFNGNTQARETPIPTVNIFYQHQ
PCFLPFHLADKKHPLTGTWQLQLENSNQIISGKIKARGITLPQDLPLGYHQLQLKTVDKT
FNCTIIIAPERCYQPQAVIEQKRLWGTFLQLYTLKSAHNWGIGDFGDLKDFIQQIAPYQA
DFIGLNPIHSLFPANPNSASPYSPSSRRWLNIAYIDINQLAEFQQSDEAQTWFHSAEIQQ
QLSELRTQDWLNYEQIIPLKLKGLRFAFAKFQQNMTACAAPAFIEFVQKGGESLQVQATF
DALHQHLSAQFADQWGWDFWEKAYQDYHSAAVQQFRETHKTDIEFYLWLQFVADQQLAEC
DAICRQQNMRIGMYRDLAVGVSPNGAETWNDKQLYCLNASVGAPPDVLGPQGQNWGLTPM
NPHVLKQQAYRPFIELVRANMSHCGALRLDHIMSLLRLWWIPKGDSAVNGAYIRYPVDDL
IAILALESQRHQCLIIGEDLGTVPKEIVSKLKNAGILSYKIFYFEFDEQGKSRDLQHYPY
QAMTTLSTHDLPTINGYWRGYDFELGEKFGVYPNSNILAILKQDRVNAKAKILQRLQEHN
VEIAPEISEQLNSPVNTAFIHCLQTYVANVSSGLFGFQPEDWLGMTEPVNIPGTSTQYAN
WRRRLSVNLEEIFTDKDIQALLKEVNLIRKNQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactgccaaacaatattatcgggctggaattatgccctattttttcgatgag
cgtggtgtaaaaaaaacagcatctgaaaaaataaaacattcgttattcaaagcctttaac
ggcaatactcaagcaagagaaacacctatccctacggtcaacattttttaccagcaccaa
ccctgttttttaccttttcatttagcggataaaaaacatccgttaaccggtacttggcag
ctacaactagaaaattcaaaccaaattatttccggcaaaattaaagcaaggggaattaca
ttacctcaagatttgcccttaggttatcaccaattacagctaaaaacggtagataaaacc
tttaattgcaccattattatcgctccggaacgctgctaccaaccacaagccgtcattgaa
caaaaaagattgtggggaaccttcctacaactatacaccttaaaatcagcccacaactgg
gggattggcgattttggcgatttaaaagacttcattcaacagattgccccttaccaagca
gattttatcggcttgaacccgattcactcactttttccggcaaacccgaattctgccagc
ccatacagtccatcctctcgccgatggctgaatattgcttacattgatatcaatcagcta
gcggaatttcaacaaagtgatgaagcacaaacttggtttcattctgctgaaatccaacaa
caattatcagaattacgcactcaggattggttgaattacgagcaaatcattccgttgaaa
ttgaaagggctacgctttgctttcgcaaaatttcagcaaaatatgaccgcttgcgctgcc
cctgcttttatcgaatttgtacaaaaaggtggtgaaagcttacaagttcaagccacattt
gatgcccttcatcagcatctatcggcacaatttgccgaccaatggggctgggatttctgg
gagaaagcctaccaagactaccactccgcagccgtgcagcaatttagagaaacgcataaa
accgacatagaattttacctttggttacaattcgttgccgatcaacagctagcagaatgt
gatgctatctgccgtcagcaaaatatgcgtattggtatgtatcgcgatctcgccgttggc
gtcagcccgaatggtgcagaaacgtggaatgacaaacaactttattgcttaaatgcctct
gtcggcgctccgcctgatgtattaggtccgcaaggacaaaactggggcttaaccccaatg
aatccgcatgtattaaagcaacaagcctaccgtccgtttattgagttagtcagagctaat
atgagtcattgcggtgcattacgccttgaccatattatgtctttactccgtttatggtgg
atccccaaaggcgatagtgcggttaatggtgcttatattcgttatccagttgatgattta
atcgcaattttggcacttgaaagccaacgccaccaatgcctaattatcggtgaagattta
ggtactgtgccaaaagaaattgtgagcaagctcaaaaatgcggggattttatcttacaaa
attttctattttgaatttgatgaacaagggaagagtcgagacttacagcattacccttac
caagcaatgaccacattaagcacccacgatttaccgactatcaatggttattggcgtggc
tatgattttgaattaggcgaaaaattcggcgtctatcctaattcgaatattttggcaatc
cttaagcaagatcgagtcaatgccaaagccaaaatcttacaacgcttacaagaacataac
gtagagatcgcacctgaaattagcgagcaacttaattctccggtgaataccgcatttatt
cactgtttacaaacctatgttgcaaatgtaagcagcggattattcggcttccaacccgaa
gactggttgggtatgactgagccggttaacattccgggaaccagtacacaatatgcaaac
tggcgacgtcggcttagtgttaacctcgaggagatcttcacagataaagatattcaagcc
ttattaaaagaagttaatttaatccgtaaaaatcaataa

DBGET integrated database retrieval system