KEGG   Mannheimia haemolytica USMARC_2286: N220_05770Help
Entry
N220_05770        CDS       T02758                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1128457..1129140
Genome map
AA seq 227 aa AA seqDB search
MKKNLITLGLMCLSTITFASDAKLKSQLEKIGATDVKISDSPLTGFKMATSNEGVVYISQ
DGRYVIQGKVFELKNGKAIDITNQGLLAELNSYTNEMIVYPAKNEKHVITVFMDITCHYC
HLLHTKIKEYNDLGITIRYLAFPRGGMNTQTAKQMEAIWTSADKVKALNDAEDGKLPTQI
KTPDIVKKHYQLGIKFGVTGTPNMVTSEGELIGGYVEPKELAKMLSE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatctaatcactttaggattaatgtgtttatcaaccatcacgtttgcttca
gatgcaaaactaaaaagccagcttgaaaaaattggagccacagatgttaaaatttcagat
tctccattaacaggctttaaaatggcgacttcaaatgaaggtgttgtatatatcagccaa
gacggtcgttatgtaattcaaggtaaagtatttgagctaaaaaatggtaaagcgattgat
attactaatcaaggattgttggcagaattgaattcatacactaatgaaatgatcgtatat
ccagcgaaaaatgagaaacatgtgattacggtgtttatggatattacttgccattattgc
catttactacatactaaaatcaaagaatataatgatttaggtattaccattcgctatttg
gcattcccgcgtggtggaatgaatacccaaacagcaaaacaaatggaagctatttggaca
tcagcagacaaagtaaaagcactgaatgatgctgaagatggtaaattaccaacccaaata
aaaacgccggatattgtgaaaaaacattaccaattagggattaaatttggtgtgacaggt
accccaaatatggtaacttcagaaggtgagttgattggtggttatgtagagcctaaagaa
ttagcgaaaatgttaagtgagtaa

DBGET integrated database retrieval system