KEGG   Mannheimia haemolytica USMARC_2286: N220_06945Help
Entry
N220_06945        CDS       T02758                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhal00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    N220_06945
Enzymes [BR:mhal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     N220_06945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358915..1359496
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVNSRIGISQEAN
LFTADTNLFAEIKALHSNKALHCILIDEAQFLTKTQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVVRLNEKGEAIKDGEQIQIGGNDRYLS
VCRYHYKQKLGKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttactactcctcaatgaatgcaggcaaatctactactctgctt
caatcttcttataattaccaagaacgtggaatgaacactttagtttataccgccgctatt
gatgaccgtttcggtgtggggaaagtcaactctcgtatcggtatttcacaagaagccaat
ttatttaccgctgataccaatctatttgcggaaattaaggcattacactcaaacaaagcg
ttacactgtatcttgattgatgaggctcagtttttaactaaaacacaggtttatcaatta
agtgatgtggtcgataaactcaaaattccggtgctttgctacgggctacgcaccgatttc
caagctgaattatttgaaggtagcaaatatttgttggcttgggcagatgagctggaagaa
ctcaaaaccatctgtgattgtggcaaaaaagcccattttgtcgttcgattaaatgaaaaa
ggcgaagccattaaagacggtgaacaaatacaaatcggcggcaatgatagatatctctct
gtttgccgttatcattacaaacaaaagttaggtaagctataa

DBGET integrated database retrieval system