KEGG   Mannheimia haemolytica USMARC_2286: N220_07315Help
Entry
N220_07315        CDS       T02758                                 

Definition
lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Brite
Enzymes [BR:mhal01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     N220_07315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1425077..1425646)
Genome map
AA seq 189 aa AA seqDB search
MSKSLKYGSGIVCGIAAIITLVQYQHPEIRTNQAGLEIIGNAEGCRRDPYKCPADVITVG
IGSTEFGGEKIDPNRIYSDKEIAERWAKDLKIAESCVNRHFNGKDMNDNQFSGMTSAVFN
MGCYNMRFYRNKQGQYVQTTIHKLAVNKQFEEMCHRLPDFIRASGKVLNGLVIRREKEKA
LCLTGLVAR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaagccttaaatatggcagtggtatcgtttgtggtatcgctgccattattaca
ttagtccaatatcaacatcccgaaatccgcactaaccaagctggattagagattatcggt
aatgctgagggttgcagacgtgatccgtataaatgccctgccgatgtaatcacggttggc
attggctcaacggagtttggcggtgaaaagattgacccaaatcgtatttattctgacaaa
gaaattgctgagcgttgggcaaaagatttgaagattgcggagagttgtgtcaatcgtcat
tttaatggtaaagacatgaacgataatcaattttcgggaatgacgtccgctgtatttaat
atgggttgttataacatgagattttatcggaataaacaaggtcaatatgtgcagactacc
atccataaactcgcagtgaataaacaatttgaggagatgtgtcatcgactacctgacttt
attcgtgccagtggtaaggtattgaacggattggttatccgccgtgaaaaggagaaagca
ttatgcttaactggattagtggcacgatag

DBGET integrated database retrieval system