KEGG   Mannheimia haemolytica USMARC_2286: N220_12425Help
Entry
N220_12425        CDS       T02758                                 

Definition
5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhal03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2359753..2360577
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETSVRGVSPYLVGQTIEQIIVRQPKLRWTVSPELSQMAGAKITAVERRAKYLI
IRTDKGDILVHLGMSGSLGILQERQQKEIGKHDHVDLITQNGTILRYNDPRKFGCWLWAE
KAEDHELLRKLGPEPLSNDFTADYLFAKSRKKTTACKTFIMTNEVVVGVGNIYACESLFM
AGIHPELAAQNLTKKQCERLVKTIKEVLTKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYG
RKGETCNDCGKPIETKVIGQRNTYFCPKCQRLPK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagcgttcgtggtgtatcgccctatttggttggg
caaactattgaacaaatcatcgttcgtcagccaaagttacgttggacggtgagtcctgaa
ttaagccaaatggcaggggcaaaaattaccgcagtagaaagacgtgccaaatatctgatt
atccgcaccgacaaaggcgatattttggtgcatctgggaatgtccggctcgctcgggatt
ttgcaagaacgtcaacaaaaagaaattggcaaacacgaccacgtcgatcttattacccaa
aacggcacaattttacgctataacgaccctcgcaaattcggctgttggctatgggcagaa
aaagcagaagatcacgaactgttgcgtaaactcgggcctgaaccgctttcaaacgatttc
acagcagattacttatttgcaaaaagccgcaaaaaaacgaccgcttgtaaaacctttatt
atgaccaatgaagtggttgttggggtggggaatatctatgcgtgcgaaagtttatttatg
gcaggcattcaccctgagcttgcagcacaaaacctgactaaaaaacagtgcgaacgttta
gtaaaaaccatcaaagaagtgctgactaaagcgattattcaaggcggcacaacactgaaa
gattttatccaacctgacggcaaaccaggctattttgctcaagtgttgcaagtgtatgga
agaaaaggggaaacctgtaatgactgcggaaagccgattgaaactaaagtaatcgggcaa
cgtaatacctatttttgcccgaagtgtcagagattgccgaagtaa

DBGET integrated database retrieval system