KEGG   Mannheimia haemolytica USMARC_2286: N220_12515Help
Entry
N220_12515        CDS       T02758                                 

Definition
catalase
Orthology
K03781  
catalase [EC:1.11.1.6]
Organism
mhal  Mannheimia haemolytica USMARC_2286
Pathway
Tryptophan metabolism
Glyoxylate and dicarboxylate metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhal00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    N220_12515
  Amino acid metabolism
   00380 Tryptophan metabolism
    N220_12515
Enzymes [BR:mhal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     N220_12515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2380637..2382145
Genome map
AA seq 502 aa AA seqDB search
MSKCPVTHLTMNNGAPVVDNQNSLTAGPRGPLLAQDLWLNEKLANFVREVIPERRMHAKG
SGAFGTFTVTNDITKYTRAAIFSQVGKKTEMFARFTTVAGERGAADAERDIRGFALKFYT
EEGNWDMVGNNTPVFFLRDPRKFPDLNKAVKRDPRTNMRSATNNWDFWTLLPEAFHQVTI
VMSERGIPASYRHMHGYGSHTYSFINAANERFWVKFHFHTQQGIKNLTNEEAAAIIANDR
ESHQRDLYEAIERGDFPKWKMFVQIMPETDADKVPYHPFDLTKVWPKSDYPLIEVGEFEL
NRNPENFFADVEQSAFAPSNLVPGISVSPDRMLQARLFNYADAQRYRLGVNHHQIPVNAP
RCPVHSNARDGQGRVDGNYGSTIHYEPNSFGKWQEQAQYAEPPLKINGDAAHWNYREDDA
DYFSQPRVLFNMMNDEQKQALFNNTAAGMGDALDFIKYRHIRNCYACDPAYGEGVAKALG
MTVEDAIAARATDPALGQPGLL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaatgtcctgttacacatttgacaatgaacaacggtgcacctgttgttgataac
caaaacagcttaacagcgggtccacgtggtccattattagcgcaagatttatggttaaat
gaaaaattagcgaacttcgtgcgtgaagtcattcctgagcgtcgtatgcacgctaaaggt
tccggtgcgttcggtactttcactgtaactaacgacatcactaaatacactcgtgcggca
atttttagccaagtcggtaaaaaaactgaaatgtttgctcgtttcaccaccgttgcaggt
gaacgtggtgcggcagatgctgagcgtgatattcgtggtttcgcattaaaattctatacc
gaagaaggtaactgggatatggtgggtaacaacacccctgtgttcttcttacgtgaccca
cgtaaattcccggatttaaacaaagcggttaaacgtgacccacgcacgaatatgcgttct
gcaactaacaactgggatttctggacattattaccagaagcatttcaccaagtgactatt
gtaatgagtgaacgtggtattccggcttcatatcgtcatatgcacggttatggctcacat
acttatagcttcatcaatgcagctaatgagcgtttctgggtgaaattccatttccataca
caacaaggcattaaaaacttaactaacgaagaagcagccgctattatcgctaacgatcgt
gaaagtcaccaacgtgatttatacgaagcgattgagcgtggcgatttcccgaaatggaaa
atgtttgttcaaattatgcctgaaactgatgcagacaaagtaccataccacccgttcgat
ttaactaaggtatggccgaaatcagactatccgttaattgaagtgggtgagtttgaatta
aatcgtaaccctgaaaacttctttgctgatgtggaacaatctgcattcgcaccaagtaac
ttagtgccgggcatcagcgtgtctccagaccgtatgttacaagctcgtttattcaactat
gcggatgctcaacgctaccgtttaggtgtgaaccaccaccaaatccctgtaaacgctcca
cgttgcccggttcatagcaacgctcgtgacggtcaaggtcgtgtggacggtaactacggt
agtaccattcactacgaaccaaacagcttcggcaaatggcaagaacaagctcaatatgca
gagccaccactgaaaattaatggtgatgcagcccactggaactatcgtgaagacgatgct
gactacttcagccaaccacgtgtattgttcaatatgatgaatgatgaacaaaaacaagca
ttattcaataatactgctgcaggtatgggcgatgcattagacttcattaaataccgtcat
attcgtaactgctatgcctgtgatccggcatatggtgaaggtgtggcaaaagcattaggt
atgacggttgaagatgctattgctgcaagagcaacagacccagcattaggtcaaccgggt
ttactctaa

DBGET integrated database retrieval system