KEGG   Mannheimia haemolytica D171: J450_01505Help
Entry
J450_01505        CDS       T02747                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mham  Mannheimia haemolytica D171
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(345211..345894)
Genome map
AA seq 227 aa AA seqDB search
MKKNLITLGLMCLSTITFASDAKLKSQLEKIGATDVKISDSPLTGFKMATSNEGVVYISQ
DGRYVIQGKVFELKNGKAIDITNQGLLAELNSYTNEMIVYPAKNEKHVITVFMDITCHYC
HLLHTKIKEYNDLGITIRYLAFPRGGMNTQTAKQMEAIWTSADKVKALNDAEDGKLPTQI
KTPDIVKKHYQLGIKFGVTGTPNMVTSEGELIGGYVEPKELAKMLSE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaaatctaatcactttaggattaatgtgtttatcaaccatcacgtttgcttca
gatgcaaaactaaaaagccagcttgaaaaaattggagccacagatgttaaaatttcagat
tctccattaacaggctttaaaatggcgacttcaaatgaaggtgttgtatatatcagccaa
gacggtcgttatgtaattcaaggtaaagtatttgagctaaaaaatggtaaagcgattgat
attactaatcaaggattgttggcagaattgaattcatacactaatgaaatgatcgtatat
ccagcgaaaaatgagaaacatgtgattacggtgtttatggatattacttgccattattgc
catttactacatactaaaatcaaagaatataatgatttaggtattaccattcgctatttg
gcattcccgcgtggtggaatgaatacccaaacagcaaaacaaatggaagctatttggaca
tcagcagacaaagtaaaagcactgaatgatgctgaagatggtaaattaccaacccaaata
aaaacgccggatattgtgaaaaaacattaccaattagggattaaatttggtgtgacaggt
accccaaatatggtaacttcagaaggtgagttgattggtggttatgtagagcctaaagaa
ttagcgaaaatgttaagtgagtaa

DBGET integrated database retrieval system