KEGG   Mannheimia haemolytica D171: J450_09985Help
Entry
J450_09985        CDS       T02747                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mham  Mannheimia haemolytica D171
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mham00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    J450_09985
Enzymes [BR:mham01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     J450_09985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2071838..2073877)
Genome map
AA seq 679 aa AA seqDB search
MSNKQNTAHYFYSPNIKEYASPSAFEKIERLLNTDNDLQKNNQILPLVKVITQPNAEQQA
VEISLNFTNVAKWQIVLENGEVRNGEIKAEQSVLTLPADLPLGYHQLSISTENDEESCSL
IVTPPKAFQPKPLEERKKLWGAFLQLYTLRSDNNWGIGDFGDLKQFLANISDYGADFVGL
NPIHALFPADPDAASPYSPSSRLWQNIIYIDVCAVEAFQQSEQAQQWFNSEETQRQLAEL
RAKDYVDYSQVAQLKLKALQFAFEHFSQPSQQQSQTEFNAFIEQAGEPLKIQATFDALHQ
WISSEFGEKGDWTNWAEEYQSYHSPKVAEFQTSQATQIRFYMWLQFVANQQLAECNQFAQ
SLSMPIGFYRDLAVGVTQSGAETWADKALFVQEASIGAPPDMLAPNGQSWGLSPMHPHIL
QSRGYQPFIDLVRANMKHCGALRIDHILGFARMWWVANGESAKEGIYVRYPLEDLLSILA
LESQRHQCLVIAEALGIVPEGILDSLEQKGIFAYNVFYFEKAENAFKPLEDYPYQAMTTL
STHDLPTIQGYWKGYDFELGEKFNTYPSKAVLRKLKEERSYDRLNIRNAVEKVMELEPNE
VGVTMKFTHQLQRYVAHTHSALFGTQPEDWLNMLEPVNIPGTSTEYPNWRRKLSATTEQI
FANKDIQQLLKDINEIRKG
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacaaacaaaatacagctcactatttttactccccaaatattaaagagtatgcc
agcccctctgcttttgagaaaatagagcggcttttaaataccgataacgatttgcaaaaa
aataatcaaattctaccgcttgttaaagtgattactcagccaaatgccgagcaacaagcg
gtcgaaatttcgctgaattttacaaatgtagcaaagtggcaaattgtgcttgaaaatggt
gaggttcggaacggtgaaattaaggcagagcaatcagttctaaccctgcctgccgatttg
cctttaggctatcatcagctttctatttcaactgaaaatgatgaagaatcttgctcgctg
attgtaacaccgccgaaagctttccagcctaagccattggaagaaaggaaaaagctctgg
ggtgcatttttacagctttatactttgcgttccgataacaactggggaattggcgatttt
ggcgatctcaaacaattccttgccaacatttctgattatggtgcagattttgtgggctta
aaccctattcacgccctttttccggcagatcctgatgcggcaagcccttacagcccgtcc
tctcgactttggcaaaatattatttatattgatgtttgtgcagtagaagcctttcaacaa
tctgaacaggctcaacaatggtttaacagtgaagaaactcaacggcagcttgctgaattg
cgagcgaaagattatgtcgattacagccaagtagcgcaactgaaattaaaggctctgcag
tttgcttttgagcatttttcacagccatctcaacaacaatcgcaaaccgagttcaatgcc
tttattgagcaagcgggcgagccattaaaaatccaagcgacgtttgatgccttgcaccaa
tggatttcatctgaatttggcgaaaaaggcgactggacaaactgggcggaggaataccaa
agttaccattcgcctaaagtagcagaatttcaaacctcacaggcaacgcagatacgtttt
tatatgtggttgcaatttgtggcaaaccagcaattagcagaatgcaaccaatttgctcaa
tcactttcaatgccgattggtttttaccgcgatttagccgttggtgttacccaaagcgga
gcagaaacgtgggcggataaagccttatttgtgcaagaggcgtcaatcggtgcaccacct
gatatgctcgccccgaacgggcaaagctgggggctttctccaatgcacccgcatatttta
caaagccgaggttatcagccgtttattgatttagtgcgtgctaatatgaaacattgtggg
gcattgcgaatcgaccatattctcggctttgctcgtatgtggtgggtggcgaacggtgaa
tcggcaaaagaagggatttatgtccgttatccgctcgaagatttgctctctattttggca
ttagaaagccaacgtcaccaatgtttagtgattgcagaggctcttggcattgtgcctgaa
ggtattttggattctctcgagcaaaaaggcatttttgcctacaatgttttttattttgaa
aaggcagaaaacgcgtttaaaccgctggaagattatccttaccaagcaatgacaacccta
agcacccacgacttaccaaccattcaaggctattggaaaggctatgattttgagctaggc
gaaaaatttaacacttacccaagcaaagccgtattgagaaagctgaaagaagagcgttcg
tatgaccgcttgaatatccgtaatgcggtggaaaaagtgatggaactcgagccaaatgaa
gtgggggtcacaatgaaatttacccatcagctacaacgctatgtggctcacactcacagt
gcattattcggtacacagcccgaagattggctcaatatgttagagccggtgaacattccg
ggaaccagcaccgaataccctaactggagaagaaaattatccgcaaccaccgagcagatt
tttgcaaataaagatattcaacaactgctaaaagatataaacgaaattcgtaaaggataa

DBGET integrated database retrieval system