KEGG   Mannheimia haemolytica D171: J450_11770Help
Entry
J450_11770        CDS       T02747                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mham  Mannheimia haemolytica D171
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mham00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2428408..2430630
Genome map
AA seq 740 aa AA seqDB search
MQDYTYSEKDAFFVERLSSGSCNDPFSYLGIHPSNNGVIIRVFLPSAIACQVIDLNGKPV
SSMLKIDDRGFFIAELIGKKTDFSYRLLVEYPDLTVDIEDPYRFKTHIQELDNWLFAEGK
QLRPYEKLGAHLVTQNEVGGVHFSVWAPNAQRVSVVGDFNHWNGLVHSMRFHPDSGIWDI
FLPNVKKGACYKFEVLDRNGVLRLKSDPYAFASQFRPETASIVSGLPSIVPAEKTCRNAN
APDKPISIYEVHLGSWRRNIENNYWLSYEELADELIPYVKDMGFTHIELLPISEFPFDGS
WGYQTTGIYSPTSRFGTPEGLSYFIQKAHDKGIGVILDWVVGHFPVDEHGLVYFDGTHLY
EHSDPKEGYHKDWNTLIFNYGRNEVSNYLSGNALYWIERFGIDALRVDAVASMIYRDYSR
SDGEWIPNKYGGRENLEAIDFLRHTNNILRDESQGGASIAEESTSFAGVSHSTERGGLGF
NYKWNMGWMNDTLRYMQKDPIYRRYHHNLMTFGMTYQYSEQFVLPLSHDEVVHGKGSLLN
KMPGDCWQKFANLRAYYGYMWGYPGKKLLFMGNEFAQGKEWNFAESLDWYLLGEEGGEWH
KGVLGWVKALNYLYTQTPALFEQDYNPEGFEWLVMDDHDNSVFAFERKAKNGDSVIVVSN
FTPIVRENYRFGVNELAEYQEILNSDLACYCGSNVSNANRFASELIASHGKAYSLSITLP
PLSTIFLKRAADKKTTQNIT
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactatacttattctgaaaaagatgctttttttgttgagcgactttcttcgggt
tcttgtaatgatcctttctcctacctaggtattcaccctagcaataacggcgttattatt
agggtatttcttccttctgctatagcttgccaagtgatcgatttaaacggaaagcctgtg
tcatcaatgctaaaaattgatgatagaggcttttttattgcagagctgattggtaaaaaa
acagatttttcttaccgcttgttggtggaataccccgatttaacagtagatattgaagac
ccttaccgttttaaaacccacattcaagagctggataactggctgtttgccgagggaaaa
caacttcgcccgtacgaaaaattgggggcacatttagtcacgcaaaatgaggttggtggt
gtgcattttagcgtatgggcaccaaatgcacagagggtttctgtggttggggatttcaac
cactggaacggtttggtgcattcaatgcgattccaccccgattccggcatttgggatatt
ttcctgccgaatgtgaaaaaaggggcttgctataaatttgaagtgttggatcgaaacggc
gtgttgcgtttgaaatctgacccttacgcctttgcctcccaattccgccccgaaaccgca
tctattgtttccggcttgccaagcattgtgccagccgagaaaacctgccgtaatgcgaat
gctcccgataaaccgatttccatttatgaagtgcatttaggctcttggcgacgcaatatt
gaaaacaattattggcttagctatgaagaactcgctgatgaactcattccttatgtgaaa
gatatgggctttacccatattgaattgctgcctatttccgaatttccgtttgatggctct
tggggttatcaaaccaccggcatttattcgccaaccagccgttttggtacgcctgagggc
ttgagttactttatccaaaaagctcacgataaaggcattggtgtgattcttgactgggta
gtggggcattttccggtagatgaacacggcttggtttattttgatggaacgcatttatac
gaacattccgatccgaaagagggctaccacaaagattggaataccttaatttttaactac
ggcagaaatgaggtgagcaattatttgtctggtaatgcactttattggattgagcgtttt
gggattgatgcgttgcgggtggatgcggtggcgtcaatgatttatcgtgattactcacgt
tcagacggcgagtggattccaaataaatatggcggacgtgagaacttagaggcaatcgac
ttcttacgccacaccaataatattttgagagacgaaagccaaggcggtgcgagcattgca
gaggagtccacctcttttgccggcgtgtctcactccactgaaagaggcggtttgggcttt
aattataaatggaatatgggctggatgaacgacactttacgctatatgcaaaaagatcca
atttaccgccgttatcaccacaatttaatgacttttggtatgacttaccaatacagcgaa
cagtttgtgttaccgctttcacacgatgaagttgttcacggcaaaggttcattgctgaat
aaaatgccgggggattgctggcaaaaatttgcgaacttacgagcctattatggctatatg
tggggctatccgggcaaaaaattgctctttatgggcaacgagtttgctcaaggtaaagag
tggaattttgccgagagcttagattggtatttactcggggaagaagggggcgaatggcat
aagggcgtattgggttgggtaaaagcccttaactatttatacacccaaacccctgcactg
tttgagcaagattacaatcctgaaggttttgagtggttagtgatggacgatcacgataat
tcggtgtttgcttttgagcgtaaagccaaaaatggcgattcggtgattgtggtgagtaat
ttcaccccgattgtgcgtgaaaattaccgttttggggtgaatgaattggcagaatatcag
gaaattctcaattctgatttagcttgttattgcggtagtaatgtcagcaatgcaaaccga
tttgccagcgagttaattgcatcgcacggtaaagcctactccttgagcattactttgcca
ccgctatcgactatcttcctcaaaagagccgcagacaaaaaaacaacacaaaacataact
taa

DBGET integrated database retrieval system