KEGG   Mannheimia haemolytica D174: J451_01040Help
Entry
J451_01040        CDS       T02748                                 

Definition
2-oxoglutarate dehydrogenase E1
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    J451_01040
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    J451_01040
  Amino acid metabolism
   00310 Lysine degradation
    J451_01040
   00380 Tryptophan metabolism
    J451_01040
Enzymes [BR:mhao01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     J451_01040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(179840..182653)
Genome map
AA seq 937 aa AA seqDB search
MQYTHFDDWLASSALGGANQSYIEEIYEQYLENPANVDESWRNIFDSFPKTPQVEQAHTP
IRDYFRKLAREQQPQSVTIIDPEAGAKQVRLLQWINAHRFRGYLEAKLDPINYYRWKTSS
VPELDYKYHGFTDEDLNETFTVGRYVYDKDTMKLSELDKALKETYLGPIGLEFMHVQDIE
QRNWLQAKMESVLNKPLFTKAEKLNLLSELTAADGLERYLGAKFPGAKRFSLEGSDAFIP
MMKEIIRHASRQGMTDVVLGMAHRGRLNMLVNVFGKRPAELFDEFAGKHADESRTGDVKY
HQGFSSNFAVDDKNVHLTLAFNPSHLEIVSPVVIGSVRARQERMRDIEHEKVLAVTVHGD
SAVAGQGVVQETLNMANVRGYKVGGTIRIVINNQIGFTTSNPNDTRSTEFCTDIAKMIQA
PIIHVNGDDPEAVAFAARMAVEYRTKFKRDIFIDLISYRRHGHNEADEPLATQPMMYSII
KKHPTPRKVYADRLITEGVLTNEQEIEMLNLYRDALDNGECVVPEWREMDMAAVDWLQYL
NYDWTALYESKFPEERFLTIAKRVCEYPASLKAHSRVEKIYTDRKEMYEGKKLFDWGMAE
TMAYATLLDEGTHVRLSGEDAGRGTFFHRHAVIHNQNDGTGYVPLTQLHANQGRFQVWDS
VLSEEAVLAFEYGFATTDPKTLTIWEAQFGDFANGAQIVIDQFISSGEQKWGRMCGLVML
LPHGYEGQGPEHSSARVERYLQLCAQQNIQVCVPSTPAQVYHMLRRQAIRKMRRPLVAIT
PKSLLRHPLAVSSLDELINGSFQNVIGELDNIDPKQVKRVVMCSGKVYYDLIEKRRENNQ
TDVAIIRIEQLYPFPLEEMQQILEPYAHVKDFVWCQEEPLNQGAWYCSKHNFEASLPEDA
KLTYAGRPASASPAVGYPSLHAKQQKQLVEDALTIAE
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatacacattttgatgattggcttgcatcatctgcattaggcggtgcaaaccaa
tcttatatagaagaaatttatgaacagtatctagaaaatccagcaaatgttgatgaaagc
tggagaaacatctttgattcatttcctaaaactccccaagttgaacaagctcacacccct
attcgtgactatttccgtaaattagcccgtgaacagcaacctcaatccgtcactattatt
gacccagaagcaggggcgaaacaagttcgcttactgcaatggattaacgctcaccgtttc
cgtggctatttagaggcaaaactagacccaattaactattaccgttggaaaacctccagc
gtgcctgaattggactacaaatatcacggcttcaccgatgaagatctcaacgaaactttt
acggtcggtcgctatgtctatgataaagacacaatgaagctcagcgaactggataaagcc
ctaaaagaaacttatttagggcctattggtttagaatttatgcacgttcaagatattgaa
caacgcaactggcttcaagccaaaatggaaagcgtgctaaacaaaccgctgttcaccaaa
gcagaaaaactgaatttattaagcgaattgaccgctgccgatggtttagagcgttactta
ggggcaaaattcccgggggcaaaacggttctcattggaaggtagtgatgcctttattccg
atgatgaaagaaattatccgccacgcttcccgtcaaggtatgaccgatgtggttttaggt
atggcacaccgtggtcgtttgaatatgttagtgaacgtatttggtaaacgcccggcagaa
ttgtttgatgaatttgccggcaaacacgctgatgaaagccgcacgggcgatgtgaaatac
caccaaggtttctcctcaaactttgccgtagatgataaaaacgttcaccttacccttgct
ttcaacccatcgcatttagagattgttagcccggtggtaatcggctcagtgcgtgcaaga
caagaacgtatgcgtgatatcgaacacgaaaaggtgcttgcggtgaccgttcacggtgac
tctgcagtggcagggcaaggtgtagtgcaagaaaccttaaatatggcaaatgttcgtggc
tataaagtaggaggcactatccgtattgtgatcaacaaccaaatcggatttaccacctct
aacccaaatgacacccgctccaccgaattttgtaccgacattgccaaaatgattcaggca
ccgattattcacgttaatggtgatgatccggaagctgttgcctttgcagcgagaatggct
gtggaatatcgtactaaatttaaacgtgatatttttattgatttaatctcttaccgtcgt
cacggtcataatgaagccgatgagcctttagcaactcagccaatgatgtatagcatcatc
aaaaaacacccgacacctcgcaaagtctatgcggatcgtttaattaccgaaggtgtttta
accaacgagcaagaaatcgagatgttaaacctgtatcgtgatgccttagacaacggcgaa
tgcgttgtgccggaatggcgtgaaatggatatggcagcggtcgattggctacaatatctc
aattacgactggactgccctatacgaaagtaaattccctgaagaacgattcttaaccatt
gccaaacgggtgtgcgaatatccggcttcgcttaaagctcattctcgggttgaaaagatc
tacactgatcgcaaagagatgtatgaaggcaagaaattattcgactggggtatggctgaa
acaatggcatacgctactttgttagacgaaggcacacatgttcgcctttcaggagaagat
gccggacgtggcactttcttccatcgccatgcggtaatccataaccaaaatgatggaaca
ggctatgtgccacttactcaactgcacgccaatcaagggcgtttccaagtatgggattcc
gtactctctgaagaagcggtactcgcctttgaatatggctttgccactaccgacccgaaa
acactgaccatttgggaagctcaatttggagatttcgctaacggagctcaaattgttatc
gaccaatttatcagctcaggcgaacaaaaatggggcagaatgtgcggtttagtgatgtta
ttaccacacggctatgaaggtcaagggccggaacactcctctgcccgagtggaacgctat
ttacagctttgtgctcagcaaaatattcaagtttgcgtgccatcaacaccggcacaggtt
taccatatgttacgccgtcaagcgatccgcaaaatgcgtcgcccattggttgcaatcaca
ccaaaatcattgctacgccacccacttgcggtgtcatctcttgatgaattgattaacggt
tcattccaaaatgtgattggcgagctcgataatatcgatcctaaacaagtcaaacgtgtg
gtgatgtgttcgggtaaagtgtactacgacttaattgaaaaacgccgtgaaaataaccaa
acggacgttgccattattcgtatcgaacagctctacccgttcccacttgaagaaatgcaa
caaattctcgagccttacgctcacgttaaagactttgtctggtgtcaagaagagccacta
aaccaaggtgcgtggtattgcagcaagcacaattttgaggcttctctgccggaagatgca
aaattaacttacgcaggcagaccggcttctgcttcaccggcggtgggttatccatcgtta
cacgcaaaacaacaaaaacaacttgttgaagatgctttaacgatcgctgaataa

DBGET integrated database retrieval system