KEGG   Mannheimia haemolytica D174: J451_02105Help
Entry
J451_02105        CDS       T02748                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mhao00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
412533..413114
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRFGVGKVNSRIGISQEAN
LFTADTNLFAEIKALHSNKALHCILIDEAQFLTKTQVYQLSDVVDKLKIPVLCYGLRTDF
QAELFEGSKYLLAWADELEELKTICDCGKKAHFVVRLNEKGEAIKDGEQIQIGGNDRYLS
VCRYHYKQKLGKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttactactcctcaatgaatgcaggcaaatctactactctgctt
caatcttcttataattaccaagaacgtggaatgaacactttagtttataccgccgctatt
gatgaccgtttcggtgtggggaaagtcaactctcgtatcggtatttcacaagaagccaat
ttatttaccgctgataccaatctatttgcggaaattaaggcattacactcaaacaaagcg
ttacactgtatcttgattgatgaggctcagtttttaactaaaacacaggtttatcaatta
agtgatgtggtcgataaactcaaaattccggtgctttgctacgggctacgcaccgatttc
caagctgaattatttgaaggtagcaaatatttgttggcttgggcagatgagctggaagaa
ctcaaaaccatctgtgattgtggcaaaaaagcccattttgtcgttcgattaaatgaaaaa
ggcgaagccattaaagacggtgaacaaatacaaatcggcggcaatgatagatatctctct
gtttgccgttatcattacaaacaaaagttaggtaagctataa

DBGET integrated database retrieval system