KEGG   Mannheimia haemolytica D174: J451_04910Help
Entry
J451_04910        CDS       T02748                                 

Gene name
malS
Definition
alpha-amylase
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943157..945214
Genome map
AA seq 685 aa AA seqDB search
MKNALPYLCLFYTSSLFAQSWQHSHFSDFNDDLEKHFFQSQVQLEKGSYPLRFKFGEQCY
QPQQAIKLNQSVALVPCINEAPQLRLFRQGNYLAQIDLRSGTPTPTISVEQQLQHNEAMF
QSCPNWDKKPIEIDVSSTFAEGESVSDFYSGNTAIVKNGKVTLMPNENASGLILLEKSNT
ENTATFDWKNATVYFVLTDRFYNGDPTNDHSYHRQKDGMQEIGTFHGGDLKGLTEKLDYL
QQLGVNVLWISSPLEQMHGWVGGGDKGDFPHYGYHGYYHLDWTKLDANMGTEDDLSRFVQ
QAHQRGIRVLFDVVMNHTGYATLADMQEFNFGGFYLTPDEISRTLGEKWTHWKPKSGQNW
HSFNDFIRFNDNQAWQNWWGKEWVRADIADYDSPKFDDLKMSLAALPDLKTESEQAVKLP
EFFANKNTNAKTLPNAKVRDYLIGWLSDWVRKYGIDGFRVDTAKHVEKSTWLVLKQSAQQ
ALNEWQKANPNAGFNDRFWMTGEAWGHGVFKSDYYQNGFDAMINFDFQDQAKQGLNCFAH
IEPIYAEMNRKLSDFNVLSYLSSHDTRLFFHSDSEQNIEKHKTAANLLLLSPGAVQIYYG
DESGRTFGATGSDLIQGTRSDMNWQELQQDPQKQALHQHWQKLTQFRQRHPAIGAGVHQL
IKNDSYFAFKRVLNEDKVMVVWAGN
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgcgttaccttatctctgcttattctatacctcaagcctttttgcccaatct
tggcaacattcccatttttctgattttaacgatgatctcgaaaaacatttttttcaatcc
caagttcaattggaaaaagggagctatccgcttaggttcaaatttggcgaacaatgttat
caaccccaacaagcgataaaattaaatcaatcggttgcgttagtcccttgtataaatgaa
gctccacaactgcggttgtttcgtcaaggcaactatctggcacaaattgatctgcgaagc
ggcactccgacacccacaatcagcgtagaacagcagctacagcacaatgaagcgatgttt
caaagttgcccgaattgggataaaaaaccgattgaaattgatgtttcttccacttttgcc
gaaggcgaatcggttagcgatttttattcaggcaacaccgctatcgttaaaaacggcaaa
gtcaccttaatgcccaatgaaaacgcaagcggtctgattttgctggaaaaaagcaatacc
gaaaatacggcaacgtttgattggaaaaatgccaccgtctattttgtgctgaccgaccgc
ttttataacggcgatccgaccaatgaccacagctaccaccgccaaaaagacggaatgcaa
gaaatcggcacctttcacggtggtgatttaaaaggattaaccgaaaagctcgattaccta
caacaacttggggtaaacgtattgtggattagctctccgttagaacaaatgcacggctgg
gttggcggcggtgataagggggattttccgcattatggctatcacggttactatcattta
gattggacgaaattagatgccaatatgggtactgaagacgatttaagtcgctttgttcaa
caagcccaccagcgtggtattcgggtgctatttgatgtggtgatgaaccataccggctac
gcgacgcttgccgatatgcaggagtttaactttggcggattttacttaacaccggacgaa
attagccgcacattaggcgaaaaatggacacactggaagccgaaatcaggacaaaattgg
cacagtttcaatgatttcattcgctttaacgataatcaggcttggcaaaattggtgggga
aaagaatgggttagagctgatattgccgattacgacagccctaaatttgatgatttaaaa
atgtcgctcgctgcccttcctgatctaaaaaccgagagcgaacaagcggtcaaattacct
gaattttttgcaaataaaaataccaatgccaaaacattaccaaacgccaaagtgcgtgat
tatttaattggttggttatccgattgggtcagaaaatatggcattgacggttttcgggtt
gataccgccaaacacgttgaaaaatccacgtggctggtattaaaacaatcggcacaacaa
gccttaaacgaatggcaaaaagccaatccgaacgccggttttaacgatcgcttttggatg
acaggagaagcgtggggacacggcgtgttcaaaagtgactattatcaaaacggttttgat
gcaatgatcaatttcgattttcaagatcaggctaaacaagggttaaattgctttgcccat
attgagccgatttatgccgaaatgaatcgcaaattaagcgacttcaatgtgttgagctat
ttatcttcacacgatactcgattatttttccattcggatagtgaacaaaatatcgaaaaa
cacaaaaccgccgcaaatttgctgttgctttcacccggtgcagtgcaaatctattatggt
gatgaaagtgggcggacatttggtgcgaccggttcagacctgatacaaggcacccggtcg
gatatgaattggcaagagttgcagcaagatcctcagaaacaggcattgcatcaacattgg
caaaaattgacacaattccgccaacgccatccggctattggcgcaggtgtccatcaactc
atcaaaaatgatagctactttgcatttaagcgtgtgttgaatgaagataaagtgatggtg
gtttgggccggaaattaa

DBGET integrated database retrieval system