KEGG   Mannheimia haemolytica D174: J451_04925Help
Entry
J451_04925        CDS       T02748                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
950669..952747
Genome map
AA seq 692 aa AA seqDB search
MKITAKQYYRAGIMPYFFDERGVKKTASEKIKHSLFKAFNGNTQARETPIPTVNIFYQHQ
PCFLPFHLADKKHPLTGTWQLQLENSNQIISGKIKARGITLPQDLPLGYHQLQLKTVDKT
FNCTIIIAPERCYQPQAVIEQKRLWGTFLQLYTLKSAHNWGIGDFGDLKDFIQQIAPYQA
DFIGLNPIHSLFPANPNSASPYSPSSRRWLNIAYIDINQLAEFQQSDEAQTWFHSAEIQQ
QLSELRTQDWLNYEQIIPLKLKGLRFAFAKFQQNMTACAAPAFIEFVQKGGESLQVQATF
DALHQHLSAQFADQWGWDFWEKAYQDYHSAAVQQFRETHKTDIEFYLWLQFVADQQLAEC
DAICRQQNMRIGMYRDLAVGVSPNGAETWNDKQLYCLNASVGAPPDVLGPQGQNWGLTPM
NPHVLKQQAYRPFIELVRANMSHCGALRLDHIMSLLRLWWIPKGDSAVNGAYIRYPVDDL
IAILALESQRHQCLIIGEDLGTVPKEIVSKLKNAGILSYKIFYFEFDEQGKSRDLQHYPY
QAMTTLSTHDLPTINGYWRGYDFELGEKFGVYPNSNILAILKQDRVNAKAKILQRLQEHN
VEIAPEISEQLNSPVNTAFIHCLQTYVANVSSGLFGFQPEDWLGMTEPVNIPGTSTQYAN
WRRRLSVNLEEIFTDKDIQALLKEVNLIRKNQ
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactgccaaacaatattatcgggctggaattatgccctattttttcgatgag
cgtggtgtaaaaaaaacagcatctgaaaaaataaaacattcgttattcaaagcctttaac
ggcaatactcaagcaagagaaacacctatccctacggtcaacattttttaccagcaccaa
ccctgttttttaccttttcatttagcggataaaaaacatccgttaaccggtacttggcag
ctacaactagaaaattcaaaccaaattatttccggcaaaattaaagcaaggggaattaca
ttacctcaagatttgcccttaggttatcaccaattacagctaaaaacggtagataaaacc
tttaattgcaccattattatcgctccggaacgctgctaccaaccacaagccgtcattgaa
caaaaaagattgtggggaaccttcctacaactatacaccttaaaatcagcccacaactgg
gggattggcgattttggcgatttaaaagacttcattcaacagattgccccttaccaagca
gattttatcggcttgaacccgattcactcactttttccggcaaacccgaattctgccagc
ccatacagtccatcctctcgccgatggctgaatattgcttacattgatatcaatcagcta
gcggaatttcaacaaagtgatgaagcacaaacttggtttcattctgctgaaatccaacaa
caattatcagaattacgcactcaggattggttgaattacgagcaaatcattccgttgaaa
ttgaaagggctacgctttgctttcgcaaaatttcagcaaaatatgaccgcttgcgctgcc
cctgcttttatcgaatttgtacaaaaaggtggtgaaagcttacaagttcaagccacattt
gatgcccttcatcagcatctatcggcacaatttgccgaccaatggggctgggatttctgg
gagaaagcctaccaagactaccactccgcagccgtgcagcaatttagagaaacgcataaa
accgacatagaattttacctttggttacaattcgttgccgatcaacagctagcagaatgt
gatgctatctgccgtcagcaaaatatgcgtattggtatgtatcgcgatctcgccgttggc
gtcagcccgaatggtgcagaaacgtggaatgacaaacaactttattgcttaaatgcctct
gtcggcgctccgcctgatgtattaggtccgcaaggacaaaactggggcttaaccccaatg
aatccgcatgtattaaagcaacaagcctaccgtccgtttattgagttagtcagagctaat
atgagtcattgcggtgcattacgccttgaccatattatgtctttactccgtttatggtgg
atccccaaaggcgatagtgcggttaatggtgcttatattcgttatccagttgatgattta
atcgcaattttggcacttgaaagccaacgccaccaatgcctaattatcggtgaagattta
ggtactgtgccaaaagaaattgtgagcaagctcaaaaatgcggggattttatcttacaaa
attttctattttgaatttgatgaacaagggaagagtcgagacttacagcattacccttac
caagcaatgaccacattaagcacccacgatttaccgactatcaatggttattggcgtggc
tatgattttgaattaggcgaaaaattcggcgtctatcctaattcgaatattttggcaatc
cttaagcaagatcgagtcaatgccaaagccaaaatcttacaacgcttacaagaacataac
gtagagatcgcacctgaaattagcgagcaacttaattctccggtgaataccgcatttatt
cactgtttacaaacctatgttgcaaatgtaagcagcggattattcggcttccaacccgaa
gactggttgggtatgactgagccggttaacattccgggaaccagtacacaatatgcaaac
tggcgacgtcggcttagtgttaacctcgaggagatcttcacagataaagatattcaagcc
ttattaaaagaagttaatttaatccgtaaaaatcaataa

DBGET integrated database retrieval system