KEGG   Mannheimia haemolytica D174: J451_06420Help
Entry
J451_06420        CDS       T02748                                 

Gene name
mrcB
Definition
bifunctional glycosyl transferase/transpeptidase
Orthology
K05365  
penicillin-binding protein 1B [EC:2.4.1.129 3.4.-.-]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mhao00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    J451_06420 (mrcB)
Enzymes [BR:mhao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     J451_06420 (mrcB)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     J451_06420 (mrcB)
Glycosyltransferases [BR:mhao01003]
 Polysaccharide
  Bacterial polysaccharide
   J451_06420 (mrcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234352..1236754
Genome map
AA seq 800 aa AA seqDB search
MSDVELNEQSEQEPEQKPKKRNYFLSTLFKIGVIGACSMAFYGIYLDGKIRSKMDGQIWE
LPAEVYARIESIKIEDNLTLEQTKQALLDNGYRQVSQVATPGDFKIEENQLVLLRRAFPF
PETPESQRVLRLTFKQDKLTYIEDLVQGKLIEEFRLDPKLLALLHSDSDEERQALRLQQY
PRLLIESLILTEDRRFYQHDGISPIGIARALITNYQAGRTVQGGSTLTQQLVKNLFLSNE
RSLVRKVNEALMSVILDFRYDKNRILETYLNEIYLGQNGSYQIHGFALASQFYFGRPIQE
ISLDQIALLVGMVKGPSLYNPWRNPQGAVERRNVVLRLLLDHQVINQELYALLSSRPLNI
REKGTIYREQPAFMQALTIDLKNELGEIKSAQLSGTKIFTTLDRKQQRSAEQAVITGLED
LESKNKKVSDLQSAIVVAEYRTGKVRAIVGDRLTQFAGFNRAIQSKRQIGSLVKPSVYAI
ALAQPELFRLNTPIQNKQISIKVGSTYWTPRNYDRSFSGSVMLMDALVRSLNIPTVNIGM
KVGLKKVIAKQKEMGWDNAEIPPYPSTLLGSYSISPYDVTRSYQVIANEGLKTPLTTIEA
IISHNGEMFYQRDSGKVSEQVLPPEAAVQTMYAMQQVVERGTARSLQNDFAKLKLAGKTG
TTNNARDTWFVGIDGEHVTTVWLGKDNNGDTNLTGSSGALYVYKQYLERALPQAYRLPKL
NTMQWVGINSYGSWNCDSGRQIPVWRDKGQRYCTSAGNVVATEKPSVWDALSLKKENIEA
KAEEAEGKQPIPTEEVAPIE
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgttgagttaaacgagcagagcgagcaagagcctgagcaaaaaccgaaaaag
cgaaactatttcctttcaaccttattcaaaatcggggtgataggagcttgcagtatggct
ttttacggcatttatttagacggtaaaatccgtagcaaaatggatgggcagatatgggaa
ttaccagctgaggtgtatgctcgtattgaaagcattaaaattgaagacaacttaacgctt
gagcaaaccaaacaagcgttgctggataacggctatcgtcaagtttctcaagttgcgaca
ccaggcgatttcaaaattgaagaaaatcagctggtgttgctacgccgagctttcccgttt
ccagaaacaccggaatcgcaacgagtgcttcgtttaactttcaaacaagataaattaact
tatattgaagatttggtgcagggtaagttgatcgaggagttccgcttggatccgaaatta
ctggcgttactgcattccgatagcgatgaagaacgtcaagcattacgcttacaacaatac
cctcgcttgttaattgagtcactgattttaaccgaagatcgccgcttttatcagcacgat
gggattagcccaatcggtattgcccgtgctttaatcactaactaccaagctggcagaaca
gtgcagggtggcagtaccttaacgcaacagttagtgaaaaacttgttcttaagtaatgaa
agatcgttggtgcgtaaggtaaatgaagcgttaatgtcggtgattttagacttccgttac
gataaaaaccgcattttagaaacctatctcaacgaaatttatttagggcagaacggtagc
taccaaattcacggttttgcattggcaagccaattctattttggtcgtccgatccaagag
attagcttagaccaaattgcgttattggtgggaatggtaaaaggtccatcactgtataac
ccgtggcgaaatccgcaaggtgcggtagagcgacgtaatgtggtgttgcgattattgctg
gatcatcaagtgatcaatcaagaactttacgctctgttaagctcccgcccgcttaatatt
cgtgaaaaaggcacgatttaccgtgagcaacctgcctttatgcaggcattaaccattgat
ttgaaaaatgagttaggcgaaattaagtcagctcaactttccggtactaaaatttttacg
acccttgaccgtaaacagcaacgttcagccgaacaagcagtgattaccggtttggaagat
ctggaaagtaaaaataaaaaagtcagcgatttgcaatcggctattgtcgtggcggaatac
cgcacaggtaaagtgagggcgatagtaggagaccgcttaacccaatttgccggctttaac
cgtgcgattcagtcaaaacgccaaatcggttctttagtcaaaccatcggtttatgcgatt
gccttggcacagcctgaattattccgtttaaatacaccgatccaaaataaacaaatttca
attaaggttggttcaacctactggacaccccgtaactacgaccgcagttttagtggctcg
gtgatgttaatggacgccttagtccgctctctgaatattccaacggtgaatattggtatg
aaagttggcttaaaaaaagtcattgccaaacaaaaagagatgggctgggataatgcggaa
attccgccttacccatcaaccttgctaggttcatattcgatctcgccttacgatgtaacc
cgctcttatcaagtaattgccaacgaagggctgaaaacaccattaaccaccattgaggcg
attatttcgcacaatggcgaaatgttctatcagcgagatagcggcaaagtgagcgagcag
gtgcttccaccggaagctgcggttcaaacaatgtatgcgatgcaacaggttgtggaacga
ggtacggctcgtagcttacaaaacgattttgccaaactgaaattagccggcaaaaccggt
acaaccaataacgctcgagatacttggtttgtgggaattgatggcgaacacgtcacaacc
gtctggctgggtaaagataacaatggggataccaacctcaccggttcaagtggtgcattg
tatgtgtataagcaatatcttgagagagccttgcctcaggcgtatagattaccgaaactt
aatacgatgcaatgggtggggattaatagctatggtagctggaattgcgatagtggcaga
caaattccagtttggcgagataaagggcaacgttattgtaccagtgcaggtaatgtagtg
gctacagaaaaaccaagtgtttgggatgcactttcgctgaaaaaagaaaatatcgaggct
aaagcagaagaagctgaagggaagcaaccaatccctactgaagaagttgcaccaattgaa
taa

DBGET integrated database retrieval system