KEGG   Mannheimia haemolytica D174: J451_06505Help
Entry
J451_06505        CDS       T02748                                 

Definition
5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mhao03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251815..1252639
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETSVRGVSPYLVGQTIEQIIVRQPKLRWTVSPELSQMAGAKITAVERRAKYLI
IRTDKGDILVHLGMSGSLGILQERQQKEIGKHDHVDLITQNGTILRYNDPRKFGCWLWAE
KAEDHELLRKLGPEPLSNDFTADYLFAKSRKKTTACKTFIMTNEVVVGVGNIYACESLFM
AGIHPELAAQNLTKKQCERLVKTIKEVLTKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYG
RKGETCNDCGKPIETKVIGQRNTYFCPKCQRLPK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagcgttcgtggtgtatcgccctatttggttggg
caaactattgaacaaatcatcgttcgtcagccaaagttacgttggacggtgagtcctgaa
ttaagccaaatggcaggggcaaaaattaccgcagtagaaagacgtgccaaatatctgatt
atccgcaccgacaaaggcgatattttggtgcatctgggaatgtccggctcgctcgggatt
ttgcaagaacgtcaacaaaaagaaattggcaaacacgaccacgtcgatcttattacccaa
aacggcacaattttacgctataacgaccctcgcaaattcggctgttggctatgggcagaa
aaagcagaagatcacgaactgttgcgtaaactcgggcctgaaccgctttcaaacgatttc
acagcagattacttatttgcaaaaagccgcaaaaaaacgaccgcttgtaaaacctttatt
atgaccaatgaagtggttgttggggtggggaatatctatgcgtgcgaaagtttatttatg
gcaggcattcaccctgagcttgcagcacaaaacctgactaaaaaacagtgcgaacgttta
gtaaaaaccatcaaagaagtgctgactaaagcgattattcaaggcggcacaacactgaaa
gattttatccaacctgacggcaaaccaggctattttgctcaagtgttgcaagtgtatgga
agaaaaggggaaacctgtaatgactgcggaaagccgattgaaactaaagtaatcgggcaa
cgtaatacctatttttgcccgaagtgtcagagattgccgaagtaa

DBGET integrated database retrieval system