KEGG   Mannheimia haemolytica D174: J451_06505Help
Entry
J451_06505        CDS       T02748                                 

Definition
5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mhao00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    J451_06505
Enzymes [BR:mhao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     J451_06505
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     J451_06505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251815..1252639
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETSVRGVSPYLVGQTIEQIIVRQPKLRWTVSPELSQMAGAKITAVERRAKYLI
IRTDKGDILVHLGMSGSLGILQERQQKEIGKHDHVDLITQNGTILRYNDPRKFGCWLWAE
KAEDHELLRKLGPEPLSNDFTADYLFAKSRKKTTACKTFIMTNEVVVGVGNIYACESLFM
AGIHPELAAQNLTKKQCERLVKTIKEVLTKAIIQGGTTLKDFIQPDGKPGYFAQVLQVYG
RKGETCNDCGKPIETKVIGQRNTYFCPKCQRLPK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacccgaagttgaaaccagcgttcgtggtgtatcgccctatttggttggg
caaactattgaacaaatcatcgttcgtcagccaaagttacgttggacggtgagtcctgaa
ttaagccaaatggcaggggcaaaaattaccgcagtagaaagacgtgccaaatatctgatt
atccgcaccgacaaaggcgatattttggtgcatctgggaatgtccggctcgctcgggatt
ttgcaagaacgtcaacaaaaagaaattggcaaacacgaccacgtcgatcttattacccaa
aacggcacaattttacgctataacgaccctcgcaaattcggctgttggctatgggcagaa
aaagcagaagatcacgaactgttgcgtaaactcgggcctgaaccgctttcaaacgatttc
acagcagattacttatttgcaaaaagccgcaaaaaaacgaccgcttgtaaaacctttatt
atgaccaatgaagtggttgttggggtggggaatatctatgcgtgcgaaagtttatttatg
gcaggcattcaccctgagcttgcagcacaaaacctgactaaaaaacagtgcgaacgttta
gtaaaaaccatcaaagaagtgctgactaaagcgattattcaaggcggcacaacactgaaa
gattttatccaacctgacggcaaaccaggctattttgctcaagtgttgcaagtgtatgga
agaaaaggggaaacctgtaatgactgcggaaagccgattgaaactaaagtaatcgggcaa
cgtaatacctatttttgcccgaagtgtcagagattgccgaagtaa

DBGET integrated database retrieval system