KEGG   Mannheimia haemolytica D174: J451_10500Help
Entry
J451_10500        CDS       T02748                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mhao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    J451_10500
Enzymes [BR:mhao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     J451_10500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052775..2053704
Genome map
AA seq 309 aa AA seqDB search
MKKLTVLGSINADHVISVPYFAKPGETLTGHSCHIAYGGKGANQAVAAARLGAKVSFIGC
IGSDDIGKAMKSAFEQDGIDTRSIKTIPNEMTGIAMIQVAESGENSIVISAGANGHLDET
VVAKCAAEITQADYLLMQLETPLPAIVQAAKLAQQNGTKVILNPAPARALPDELLNLLDM
ITPNETEAEILTGVKVVDEASAIQAAQVFHQKGIEKVLITLGSKGVFVSENGVGKIVAGF
RVQAVDTTAAGDTFNGALVTAMLEDKPLDQAIRFAHAAAAISVTRKGAQPSIPTRQETLD
FLSQQAVSF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcaccgttctcggtagcattaacgctgatcacgtgatttccgttccctat
tttgccaaaccgggggaaacgctcaccggacatagctgccacattgcttatggcggtaaa
ggggcaaatcaggcggtggcggcagcacgtttgggagctaaggtttctttcatcggttgt
attggcagtgatgacatcggcaaagcaatgaaatcagcctttgagcaagatggcattgac
actcgctcgattaaaacgattccgaatgaaatgaccggcattgcaatgattcaagtggcg
gaatcgggcgagaacagtattgtgatttcagccggagcgaacggtcatttggatgaaacg
gttgtggcaaagtgtgcagccgaaatcacacaggcggattatttgctaatgcagctagaa
acaccgttgccggcgattgtgcaagcagcaaaattggctcagcaaaacggcacgaaagta
atattaaaccctgcgcctgctcgagcgttacccgatgaactgttaaacttactggatatg
attaccccaaatgaaacggaagcggaaatattaaccggtgtgaaagttgttgatgaagcc
agtgcgattcaagccgcacaagtgtttcaccaaaagggcatcgaaaaagtgttgattaca
cttggctcaaaaggggtatttgtaagcgaaaacggtgtaggcaaaatcgttgcaggcttc
cgtgttcaagcggtggataccactgccgcaggggatacttttaacggagcattagtgact
gcaatgttagaagataaaccgctggatcaagccattcgttttgctcacgcagcggcagcg
attagtgtgactcgcaaaggggctcaaccttctattccgacccgtcaggaaacactggat
tttctaagccaacaagcggtgagtttttag

DBGET integrated database retrieval system