KEGG   Mannheimia haemolytica D174: J451_12715Help
Entry
J451_12715        CDS       T02748                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mhao  Mannheimia haemolytica D174
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mhao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    J451_12715
  Amino acid metabolism
   00330 Arginine and proline metabolism
    J451_12715
Enzymes [BR:mhao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     J451_12715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2494995..2496098)
Genome map
AA seq 367 aa AA seqDB search
MKIDKTLVVKFGTSTLTQGSAKLNLPHMIDIVRQLAQLHQAGFRLVIVTSGAIAAGRHYL
NHPQLPPTIASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQILLTRADIEDRERFLNARDT
LRALLDNQIIPVINENDAVATSEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDRDPR
KHPDAKLIADVDKITDHIRAIAGGSGTSLGTGGMSTKISAADVATRSGIETIIAPGNRPN
VIVDLAYGQAIGTKFSVQADRLESRKQWLYAAPSAGIITIDAGAENAMLIQHKSLLPAGI
VNVEGRFSRGEVVKIRTQQGKDVALGMPRYNSDALHLIQGKHSQDIEQVLGYEYGAVAVH
RDDMIVL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgacaaaacactcgttgtaaaatttggaaccagtacgcttacgcaaggatcg
gcgaagttaaatttacctcatatgatagatattgtgcgtcagctcgcacagcttcatcaa
gcgggctttcgtttagtgattgttacctcaggggcgattgcggcaggtcgtcattattta
aatcacccgcaattgccaccgacgattgcctcgaaacaattattggctgcggtaggacaa
agtcagctcattcaaacgtgggaaaaattgtttgccatttatgatattcatattgggcag
attttattgacccgtgccgacattgaagatcgtgaacgttttttaaatgccagagatact
ttgcgcgccttattagacaatcagattattccagtgattaatgaaaatgacgctgtcgct
acgtcagaaattaaagtaggcgataacgataatttatccgcgttagtggcaattttggtg
caagcagaacagttgtatttgcttactgatcagcaaggtttatttgatcgtgatccgcgc
aaacatccagacgccaaattgatcgccgacgtggacaaaattaccgatcatattcgcgcg
attgcgggcggaagtggcacctcgttaggcacaggtggcatgtccaccaaaatcagtgcc
gcggatgtggcaacccgctccggcattgaaaccattattgcaccgggtaatcgcccgaat
gtgattgtggacttagcttatgggcaagccattggcaccaaatttagtgtgcaagcagat
cgcttagaaagtcgtaaacaatggctatatgcggcgccgtcagccggtattattaccatt
gatgcgggggcggaaaacgcgatgttaatacaacataaatcgttattgcctgctgggatt
gtaaacgtggaagggcgcttttcacgcggtgaagtggtaaaaattcgtactcagcaaggc
aaggatgttgccttagggatgccacgttataacagcgatgcgctccatttaattcaaggc
aaacattcgcaagatatcgaacaggttctcggttatgaatatggggcggttgcggtacac
cgagacgatatgattgtgttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system