KEGG   Marinobacter hydrocarbonoclasticus: MARHY0396Help
Entry
MARHY0396         CDS       T02083                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mhc  Marinobacter hydrocarbonoclasticus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mhc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(433602..434357)
Genome map
AA seq 251 aa AA seqDB search
MICRPEPEASRLAEAFRKAGADARVMPMMAREPLPETPEQRGILQQLDNFSHIIAVSPYA
ARRLMEEIDHWWPQLPAGLQWYGVGAGTAAVFREHGLKPRMPAEGWTSEALLALPSLQSI
DGEKVLLARGEHGRELIRETLAQRGARITALPLYRRVLPYYSAKQVKALVADFHPEVVIA
LSGETLNNLVELGHRYQLALTPDIIVVPAERVAEQARALGFRKPLVPGSLNDDDLVISVA
SCLSQEAGDNG
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
ttgatctgccggcccgagcccgaagccagccgcctcgccgaggcctttcgcaaggccggt
gccgatgcccgggtgatgccgatgatggcgcgcgagcctttaccggaaacaccggagcag
cgcggcatcctgcagcagctggacaacttttcccacatcatcgcggtcagcccctatgcc
gcccgccggctgatggaggaaatcgaccactggtggcctcaacttcccgccggcctgcaa
tggtacggcgtgggagccggcaccgccgcggtttttcgcgaacatggcctgaaaccgaga
atgcctgccgaaggctggaccagcgaggcgttgctggcgctgccatcactgcagagcatt
gacggagagaaagtgctgctggctcggggcgagcatggccgggaactgattcgtgagacc
ctggcgcaacggggcgcacggattaccgccctgcccctgtaccggcgcgtgctgccgtac
tattctgcaaaacaggtgaaggctctggttgccgacttccaccccgaggtggtgattgcg
ctttccggcgaaaccctgaacaatctggtggagctgggccacagataccaattggctctg
acgcccgacataatcgtagtacctgcggagcgtgtggcggaacaggcgcgcgcgctgggc
ttccgcaagccactggtgcccggtagcctgaacgatgacgacctggtcatcagtgttgct
tcctgcctgtcgcaggaggccggtgacaacggataa

DBGET integrated database retrieval system