KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY0942Help
Entry
MARHY0942         CDS       T02083                                 

Gene name
dsbC
Definition
protein disulfide isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Brite
Enzymes [BR:mhc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MARHY0942 (dsbC)
Secretion system [BR:mhc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MARHY0942 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983576..984310
Genome map
AA seq 244 aa AA seqDB search
MNIKSVAASIGLALTLVGAPASQAGEAEDRIAQRLTEAVPGLKVNSVRESEAKGLYEVQS
NNGDTIYTTEDGTYLLTGDLLKITKNGIANVTEESRAGSRKDLMADYGGKGVISYPAKGK
EKAVVNVFTDIDCPYCRKLHDEVPQLNEYGITVNYYAFPRSGPGTASFNKYISVWCADDQ
QAAMDAAKAGRSVEQKSCENPVAEQYRLGGQVGVTGTPAILLEDGNMVRGYVPARNLAEG
LGIL
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcaaatcagtagcagcgtccattggactggcgctgaccctggtcggggcgcca
gcctcccaggcaggcgaagccgaagaccgcattgcccagcggctgaccgaggcggttccc
ggtctcaaggtaaactctgttcgcgaatctgaggcaaaagggttgtacgaagttcagagc
aacaacggcgacaccatctataccacggaagacggcacctatctgctgacgggcgatctg
ctgaaaatcaccaaaaacggcattgccaacgttactgaagaatcccgtgcgggttcccgt
aaggacctgatggcggattatggtggcaagggcgtgatttcgtatccggccaagggtaaa
gagaaggcggtcgttaatgtgtttaccgatatcgattgcccctattgccggaagttgcac
gatgaagtgccccagttgaatgagtacggtattaccgtcaattactacgcgtttccccgt
tccgggccaggtacggcctccttcaataaatatatctcggtctggtgcgctgacgatcag
caggccgctatggatgccgccaaggccgggcgttcggtagagcagaagagttgtgagaac
ccggtggcagagcagtatcgtctcggcggtcaggtgggtgtgaccggcacgccggctatt
ttgctggaagacggcaatatggttcggggttatgtgccggcccgaaatctggctgagggt
ctcggtattctgtga

DBGET integrated database retrieval system