KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY1840Help
Entry
MARHY1840         CDS       T02083                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (Amylomaltase)( belong to the disproportionating enzyme family) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MARHY1840 (malQ)
Enzymes [BR:mhc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MARHY1840 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1916560..1918032
Genome map
AA seq 490 aa AA seqDB search
MTVEMPSNPVLARRRAGVLLHPTALPGVSGKLGAAARQFVDVLAEAGITVWQTLPLGPTH
ADLSPYQSLSAHAGNPVLIDLAELVAPGLLDSQELTAFTRTEALEHASQRFHAGRYRESE
ALNAQAYQNFLEHHQWLDDFALFMTAREAFPGVNWLDWPEDLRDHKPTALEALRESHQST
LERVCLEQYLFFIQWTAVRHYAAERGIWLFGDIPIFVAHDSADVWAAPHLYKLDGEGKPR
VVAGVPPDYFSPEGQHWGNPLFDWQRMAEDRYHWWVQRLASQQERFDLLRIDHFRGLQAY
WEIPAENPRPVDGYWMPGPADDFLETCFRELPRLPLVAENLGIIGEDVEALRHRFRLPGM
TVIQFGFDGSAANPHLLHNHKEWDLVYTGTHDNDTTLGWYQSLDERTREHVNRYLRINGP
DMPWPVIQAAMGSVSRLVIVPIQDLLALGSEARFNTPGTIQGNWKWTLPEDYRARIDLPG
LRNIVNLYGR
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgactgtagaaatgccatccaatccggttctggcaaggcggcgtgccggtgtgctgttg
cacccgaccgcattacctggcgtttccggcaagctgggcgccgctgcccggcagtttgtg
gatgttctggccgaggcaggcatcacggtgtggcagacactgccattggggcccactcat
gcagacctttcgccgtatcagtcgctctcggcccatgccggaaaccccgttctgatcgac
ctggcggaactggtggcccccggtcttctcgatagccaggaacttaccgcctttacccgt
accgaagccctggaacatgccagccagcgattccatgccggtcgctatcgtgagtcagaa
gccctcaacgcacaggcctatcagaattttctggagcaccatcagtggctggatgatttt
gcgctgttcatgacagccagagaggcgtttccgggcgtgaactggctggactggccggaa
gacctgcgcgatcacaagccgacagccctggaggccctgagagaatcccaccaaagtaca
ctggaacgggtgtgcctggagcagtacctgtttttcatacaatggacagcggtgcgtcat
tatgcggccgaacggggcatctggctatttggcgacatccccattttcgtcgctcacgac
agcgccgatgtctgggccgccccccacctgtacaagctcgatggtgaaggtaagcccaga
gtggttgccggggtgcccccggactatttctcccccgagggtcagcactggggaaacccg
ctattcgactggcagcgaatggcggaggaccgataccactggtgggtgcagcgcctggcc
agccagcaggaacggttcgatctccttagaattgatcatttccgggggctgcaggcttac
tgggagattccggcggagaatccgcgcccggtcgatggctactggatgccgggcccggcc
gatgattttctggaaacctgcttccgggagttaccccgtttgccgctggttgccgagaac
ctcggcatcatcggggaagatgtggaagcccttcgacaccgtttccggttaccgggtatg
accgtcatacaattcggttttgatggcagcgccgccaacccccatctattgcataaccac
aaggaatgggatctggtgtataccggcacccacgacaatgacaccacactgggctggtac
cagagcctggatgagcgaacccgggagcatgttaaccggtatctgaggattaacggcccg
gatatgccatggcccgtgatacaggctgcgatgggctcggtatcacgactggtgatcgtt
ccgatacaggatcttttggctctcggatccgaggcacgcttcaacacgcctggcacgatc
cagggtaactggaaatggaccttacccgaggattatcgagcgaggatcgacctgccaggg
ctgagaaatattgtgaacctatacggtcgatag

DBGET integrated database retrieval system