KEGG   Marinobacter hydrocarbonoclasticus: MARHY2495Help
Entry
MARHY2495         CDS       T02083                                 

Gene name
ycjM
Definition
alpha amylase, sucrose phosphorylase, (trans)glycosidase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mhc  Marinobacter hydrocarbonoclasticus
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mhc00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2548578..2550314)
Genome map
AA seq 578 aa AA seqDB search
MTQPLKSKLQGMLEVVYPSVDCDFLAEQLLATMGLAPNADAPPAHQNHWDETDVLLITYA
DTLQQPDEKPLVTLKRFLDDSLKDSISAVHILPFFPFSSDDGFSVMDYLAVNESHGGWPE
IEAIARDYKLMSDLVINHMSARSRWFENYKKRIDPGKDYFFEGNPKDDLSQVVRPRTSPL
LNPVQTDDGERYVWCTFSEDQVDLNFANPQVLLEFAGIIRQYLERGVMIFRMDAVAFLWK
EPGTPCIHLQQTHELIKILRLLIEHHTPDAVVITETNVPNRENLTYFGNANEAHAIYNFS
LPPLLINTLVTGNCRHLKTWLMSMPPAQLGTTYLNFIASHDGVGLRPTDGLLTEDEKQRL
INTMESFGGKVSYRRTADGRDQPYEMNIALWDALKGTAEGGADHWQLARFLCAHTIMLAL
EGIPAFYIHSLLATENDQARVEHTGRLRSINRSQWQLSQLEETLADPLTHHSKAFRELKR
LIAIRRAQPAFHPNATQFTLHLGLQLFGFWRQSMRREQSVFCIHNISPEVQQVALSDINL
IGTDRWVDLISGMEVDDLAGSITLKPYQSVWLSNQQRR
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgactcagccactgaagagcaagctgcaaggtatgctcgaggtcgtctatccctcggta
gattgcgactttctggcggagcagttactggccaccatggggctggcgcccaatgccgac
gccccaccggcccaccagaaccattgggacgaaaccgatgtgttgctgattacctacgcg
gacacgcttcagcaaccggacgagaagccgctggtgacgctcaagcgcttcctggatgac
agccttaaggactccatttccgcggtgcacatactgccgttttttcccttcagctctgat
gatggcttttcggtgatggattaccttgcggtgaatgagagtcacggtggctggccggag
attgaggccattgcccgggactacaagttgatgtccgatcttgtgatcaaccacatgtcg
gcccgcagccggtggttcgaaaactataagaagcgcatcgacccgggtaaggactatttc
tttgaaggcaacccgaaagacgacctcagccaggtagtgaggccacgtacgtcgcccctg
ctcaatccggtgcagaccgacgacggcgagcgctatgtgtggtgcaccttcagtgaagat
caggtagacctgaactttgccaacccgcaggtactgttggagtttgcggggatcatccgc
caatacttggaacgaggtgtgatgattttccgtatggatgccgtggcctttctctggaaa
gagccgggcacgccgtgtattcatctgcagcaaacccacgagctgatcaagatcctgcgc
ttgctgattgaacatcacacgccggacgcggtagtgatcaccgaaaccaatgtacccaat
cgagagaacctgacttattttggcaatgccaacgaagcccatgccatctataacttttcg
ttgccgcctctgctgatcaacacgctggtgaccggcaattgccgacatctgaaaacctgg
ctgatgagtatgcccccggcgcagctgggcaccacctatctgaactttatcgcttcccac
gacggcgttggtctgcggcccacagatggcctgctgaccgaagatgaaaagcaacgcctg
atcaacaccatggagtcgtttgggggtaaggtgtcctaccgccggacggccgacgggcgg
gatcagccctatgagatgaacattgcgctctgggatgccctcaaaggaaccgcagaaggc
ggtgctgaccactggcagctcgcgcgattcctgtgtgcgcataccattatgctggccctc
gagggcattcccgccttttatattcacagcttgctggccacggagaacgatcaggcgcgg
gtggagcataccgggcgcctgcgctccattaaccgcagtcaatggcagttgtcgcaactg
gaggaaaccctcgcagatccactgacccaccacagcaaggcattccgggagctgaagcgc
ttgattgccatacgccgtgctcaacctgctttccatccgaacgccacgcagttcacctta
cacctggggttgcagttgttcgggttctggcgccagagcatgcgccgggagcagtcggtg
ttctgtatccataacatcagtcccgaggtgcagcaggtggcgctcagtgatattaatctg
attggaacggatcgttgggtagacttgatctccggaatggaggtggatgatctggctgga
tcaatcaccctgaagccgtatcagagtgtgtggttgtccaaccagcagagacgctga

DBGET integrated database retrieval system