KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3102Help
Entry
MARHY3102         CDS       T02083                                 

Gene name
phbA
Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain, PHB biosynthesis
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MARHY3102 (phbA)
   00630 Glyoxylate and dicarboxylate metabolism
    MARHY3102 (phbA)
   00640 Propanoate metabolism
    MARHY3102 (phbA)
   00650 Butanoate metabolism
    MARHY3102 (phbA)
  Lipid metabolism
   00071 Fatty acid degradation
    MARHY3102 (phbA)
   00072 Synthesis and degradation of ketone bodies
    MARHY3102 (phbA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MARHY3102 (phbA)
   00310 Lysine degradation
    MARHY3102 (phbA)
   00380 Tryptophan metabolism
    MARHY3102 (phbA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MARHY3102 (phbA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MARHY3102 (phbA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MARHY3102 (phbA)
Enzymes [BR:mhc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MARHY3102 (phbA)
Exosome [BR:mhc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MARHY3102 (phbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3182751..3183929
Genome map
AA seq 392 aa AA seqDB search
MRDVVIVAAKRTAIGSFGGGLSSLRADQLGTAVIKAVMEETGVAGDQINEVILGQVLTAG
CGQNPARQSAINAGLPASVPAITINKVCGSGLKAVHMAVQAIQCGDAEMILAGGQESMSQ
APHVLPNSRNGQRMGNWSMIDTMITDGLWDAFNDYHMGITAENIVEKYGITRDEQDAFAA
ASQQKAVAAQKAGYFDGQIVPVTIPQRKGDPLVVDKDECPRDGVTGDSLGKLRPAFKKDG
SVTAGNASSLNDGAAVVMVCSADKAKELGLTPLATIKAHANAGVDPTIMGTGPIPASQRC
LERAGWTVDDLDLIEANEAFAAQAISVNRDLGWDTAKVNVNGGAIALGHPIGASGCRILV
SLLHEMTRRDAKKGLATLCIGGGMGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgttgttattgttgccgccaaacgtaccgccatcggcagcttcggtggtggt
ctgtccagcctgcgtgcagaccagctgggtacggccgtgatcaaggccgtgatggaagaa
accggtgtcgccggcgaccagatcaatgaggttatcctcggccaggtactcaccgctggc
tgcggccagaacccggcccgacagtctgccatcaatgctggcctgccagcttccgtgccc
gccatcaccatcaacaaggtctgcggctccggcctgaaagccgtgcacatggcggttcag
gccatccagtgcggcgatgccgagatgatcctggccggcggtcaggaaagcatgagccag
gcgccccacgtactgcccaacagccgcaacggtcaacgcatgggcaactggagcatgatc
gacaccatgatcaccgacggcctgtgggatgccttcaacgattaccacatgggtatcacc
gctgagaacatcgtcgagaaatacggcatcacccgggacgagcaggatgcctttgccgcc
gcatcccagcagaaagccgtcgctgcgcaaaaggccggctactttgacggccagattgtt
cctgtcaccattccccagcgcaaaggcgacccactggtggtggacaaggatgagtgcccc
cgcgacggcgtcaccggcgacagcctgggcaaactgcgcccggccttcaagaaagacggc
tcggtaactgccggcaacgcttcctccctgaacgacggcgctgccgtggtgatggtgtgc
agcgcagacaaggcgaaagagctgggcctgaccccgctggcaaccatcaaagcccacgcc
aatgccggcgtggaccctaccatcatgggcaccggcccgattccggccagccagcgctgc
ctggagcgggcgggctggactgttgacgacctggacctgatcgaagccaacgaggccttc
gccgcccaggcaatttccgttaatcgggacctgggctgggacaccgccaaggtaaacgtg
aacggcggtgccattgccctggggcacccgattggcgcttccggttgccgtattctggtc
agcctgctgcacgaaatgacccgccgcgatgccaagaaaggtctggccacgctgtgtatt
ggcggtggcatgggtgtggccctggccgttgagcgctga

DBGET integrated database retrieval system