KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3350Help
Entry
MARHY3350         CDS       T02083                                 

Gene name
aceA
Definition
(GenBank) Isocitrate lyase (Isocitrase) (Isocitratase) (ICL)
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00630  Glyoxylate and dicarboxylate metabolism
mhc01100  Metabolic pathways
mhc01110  Biosynthesis of secondary metabolites
mhc01120  Microbial metabolism in diverse environments
mhc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MARHY3350 (aceA)
Enzymes [BR:mhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MARHY3350 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CCG96805
UniProt: H8W637
Position
complement(3436090..3437682)
Genome map
AA seq 530 aa AA seqDB search
MPYAQDVDQIASLVKQNPTWNAINPKHAARMRAQNKFKTGLDIAKYTAKIMREDMAAYDA
DSSKYTQSLGCWHGFIGQQKMISIKKHFGTTKRRYLYLSGWMVAALRSEFGPLPDQSMHE
KTAVSGLIEELYTFLRQADAWELNHLFRALEEAENAGDTAKAEELIKQIDNHETHVVPII
ADIDAGFGNAEATYLLAKQMIEAGACCIQIENQVSDEKQCGHQDGKVTVPHADFLSKINA
VRLAFLELGVDDGVIVARTDSLGAGLTKQIAVTNEPGDLGDQYNSFLDGEYIDDASQIEN
GDVVIKSNGKLLKPKRLASGLFCFKPGSGEDRVVLDCITSLQNGADMLWIETEKPHVGQI
AGMVNRIKEVVPDAKLVYNNSPSFNWTLNFRQQVFDAMQEEGKDVSAYDRAKLMSAEYDN
TELGQLADEWCRNFQRDASREAGVFHHLITLPTYHTAALSTDNLAKGYFGDEGMLAYVAG
VQRQEIRQGIATVKHQDMAGSNIGDDHKEFFAGEAALKAGGKDNTMNQFG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgccttacgcacaagacgtcgaccaaatcgcttccctcgtgaagcagaaccccacctgg
aacgccatcaacccgaagcacgcggcccgcatgcgcgcccagaacaagttcaagactggt
ctggacatcgccaagtacaccgccaagatcatgcgtgaagacatggctgcttacgatgcc
gattcttccaagtacacccagtctctgggttgctggcacggtttcatcggccagcagaag
atgatctccatcaagaagcacttcggtaccaccaagcgtcgttacctgtacctgtctggc
tggatggttgctgccctgcgttccgagttcggcccgctgcctgaccagtccatgcacgag
aagactgctgtttctggcctgatcgaagaactgtacaccttcctgcgtcaggccgatgcc
tgggaactgaaccacctgttccgcgccctggaagaagctgaaaacgctggcgatactgcc
aaggccgaagagctgatcaagcagatcgacaaccacgaaacccacgttgtgcccatcatt
gcggacatcgacgctggtttcggtaacgccgaagcgacctatctgctagccaagcagatg
atcgaagccggtgcttgctgtatccagatcgagaaccaggtgtctgacgagaagcagtgt
ggccaccaggacggcaaagtaaccgttccccatgccgacttcctgtccaagatcaacgcg
gttcgtctggcgttcctggaactgggtgtggacgacggcgtgatcgttgcccgtactgac
tccctgggtgctggcctgaccaagcagatcgctgttaccaacgagccgggcgacctgggc
gaccagtacaacagcttcctggacggcgagtacatcgacgacgcttcccagatcgagaac
ggcgacgttgtgatcaagtccaacggcaagctgctgaagccgaagcgtctggcctctggc
ctgttctgcttcaagccgggttctggcgaagaccgtgttgttctggactgcatcaccagc
ctgcagaacggcgctgacatgctgtggatcgaaaccgagaagccgcacgttggccagatc
gctggcatggttaaccgcatcaaggaagtggtgcccgacgccaagctggtttacaacaac
agcccgtccttcaactggactctgaacttccgtcagcaggtattcgatgccatgcaggaa
gaaggcaaagacgtatctgcctacgaccgtgccaagctgatgagcgccgagtacgacaac
actgagctgggtcagctggctgacgagtggtgccgtaacttccagcgtgatgcgtcccgt
gaagctggtgtgttccatcacctgatcactctgccgacgtaccacactgcggctctgtct
accgacaacctggccaaaggctacttcggtgacgaaggcatgctggcctacgttgctggc
gtacagcgtcaggaaatccgtcagggcatcgctaccgtgaagcaccaggacatggccggt
tccaacatcggtgatgaccacaaagagttcttcgctggtgaagcggctctgaaagccggt
ggtaaagacaacaccatgaaccagttcggttaa

DBGET integrated database retrieval system