KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3604Help
Entry
MARHY3604         CDS       T02083                                 

Definition
(RefSeq) DNA ligase ligA, ATP-dependent (EC:6.5.1.1)
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:mhc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MARHY3604
   03410 Base excision repair
    MARHY3604
   03420 Nucleotide excision repair
    MARHY3604
   03430 Mismatch repair
    MARHY3604
Enzymes [BR:mhc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MARHY3604
    6.5.1.6  DNA ligase (ATP or NAD+)
     MARHY3604
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MARHY3604
DNA replication proteins [BR:mhc03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (archaeal)
    Other elongation factors
     MARHY3604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3721937..3722824)
Genome map
AA seq 295 aa AA seqDB search
MPLCNTTRVRAMPLAFSFIVVSIFLSAFGHASGRPPALPLANVYHPGVNLEEYWVSEKLD
GVRVFWDGETLWSRGGYRYSAPAWFTRQFPAQPLDGELWSGRGRFAELSGVVRKVQPVGQ
EWRQVRFYVFDLPEPDRPFEQRYRRLQQLVTAADSRYLVLVEQRVVASHDELMARLEQTV
AAGGEGLMLKRRKSWYQAGRSDDLLKVKKHQDAEATVVAHLPGKGKYEGLLGALEVELES
GRRFRLGTGFTDEERHNPPAIGARVTFRYRGLTATGLPRFASFLRIRNDEPEIIE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccactctgcaataccacccgtgtcagggcgatgcctctggcattcagttttattgtt
gtatcaatcttcctttcagcgtttgggcacgccagtggccggccgccggctcttccgctc
gccaatgtctaccatcccggggtcaatctggaagagtactgggtcagtgaaaagctggac
ggtgtccgggtattctgggatggcgagacgctctggtctcggggcgggtacaggtatagc
gcaccggcctggtttacccgtcagtttcccgctcaaccgctggatggcgaactctggagc
ggtcgtggccgttttgcggaactatctggcgtagtccgcaaagttcagccagtaggccag
gaatggcgtcaggtgcgcttctacgtctttgatttgcccgagccagatcggccttttgag
caacgctatagacgcttgcaacagctggtgaccgcagcagattcgcgttatctggtactg
gtggaacagcgggtagttgccagccacgatgagctgatggcccggcttgagcaaacggtc
gcggccggtggtgagggactgatgctgaaacgccgcaaaagttggtatcaggcgggccgt
tcagatgacctgctcaaggtgaaaaaacatcaggatgcggaagccacagtggttgctcat
cttcccggcaagggcaagtatgagggattattgggggcactggaggtagagctggaaagt
ggtcgccggttccggcttggcaccgggtttaccgatgaggagcggcacaatccgcctgct
attggcgcccgggttacttttcgctatcgcggcctcacggctacaggcttaccccggttc
gccagctttctaagaattcgtaatgacgaaccggagattatcgaatag

DBGET integrated database retrieval system