KEGG   Marinithermus hydrothermalis: Marky_0052Help
Entry
Marky_0052        CDS       T01457                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Marky_0052
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Marky_0052
Enzymes [BR:mhd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Marky_0052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54464..55738
Genome map
AA seq 424 aa AA seqDB search
MQQPLVIQGGTPLNGELRVNPAKNAALPILVASLLTPHPVTLREVPRLRDIEVLLDLLAH
LGTRYAWEGRTLHLHTPEIVTTDAPYELVSKMRASFIVLGALLARTGEGRVSMPGGCAFG
PRPVDLHVKALRTLGAEVVEENGTFTATRTRPLAGRVIFDVPTVGGTEQVLLAAALGDTD
VTIVNAAQEPEIEDLARFLEMLGVTIEGAGTSVIHVRGARALRGGVYNVIPDRIEAGTFL
LAAAATRGRLTLTHAYPHHLDALLAKLAESGHRIEAGRDWVRLEATPNPRPFNIEAREYP
GFPTDLQPPVTAYLATVEGVSLVTDRVYPDRFTHVGELARMGAELTLKDRVLAVHGGPLH
GAEVKAFDIRAGGALVIAALAAEGETRIDGMRHVVRGYENLEARLRAVGARAYTDRAPLE
AVAD
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
gtgcagcagccgttggtcattcaggggggaacgccgcttaacggagaactccgcgtcaac
ccggcgaaaaacgccgcgcttcccatcctcgtcgcgagcctcttaaccccgcaccccgtc
accctgcgcgaggtgccgcgcctgagggacatcgaggtgctcctcgacctcctggctcac
ctcggcacccgttacgcgtgggagggacgcacgctgcacctacacaccccggaaatcgtc
acgaccgacgcaccctacgagctggtcagcaagatgcgggccagcttcatcgtgttgggc
gcgctgttggcccgcacgggtgaggggcgggtctcgatgcccggcgggtgcgcctttggt
ccccggcccgtagacctgcacgtcaaggccctgcgcacgctcggggccgaggtcgttgag
gagaacggcaccttcacggccacccgcacccgtcccctcgccggacgggtgatcttcgac
gtgcccaccgtgggcggcaccgaacaggtccttttggccgcggcgctcggcgacacggac
gtcacgatcgtgaacgccgcccaggagccggagatcgaggacctggcccggttcctcgag
atgctcggcgttacgatcgaaggggcgggcacttccgtgatccacgtgcgcggcgcgcga
gcccttcggggcggcgtgtacaacgtgatccccgaccgcatcgaggccggtaccttcctc
ctcgctgccgccgccacgcgcggccgcctcaccctcacccacgcctacccccaccacctc
gacgccctcctcgccaagcttgccgagagcgggcatcggatcgaggctgggcgcgactgg
gtgcgcctcgaggccacccccaatccccgccccttcaacatcgaggcgcgcgagtacccc
ggcttccccaccgacctgcagccgcccgtcaccgcgtacctcgcgaccgtcgagggggtc
tccctcgtgacggaccgcgtctaccccgaccggttcacgcacgtgggcgagctcgcccgc
atgggagcggagctgaccctcaaagaccgggtgctcgccgtgcacggggggccgttgcac
ggcgctgaggtgaaggcgttcgacatccgcgcggggggtgcgctcgtcatcgccgcactc
gccgccgaaggggagacccggatcgacgggatgcggcacgtggtgcgcgggtacgaaaac
ctcgaggcccgcctccgggcggtcggggcgcgcgcgtacaccgaccgcgcgccgctcgag
gcggtcgcggactaa

DBGET integrated database retrieval system