KEGG   Marinithermus hydrothermalis: Marky_0198Help
Entry
Marky_0198        CDS       T01457                                 

Definition
(GenBank) Cellulase
Organism
mhd  Marinithermus hydrothermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
198877..199911
Genome map
AA seq 344 aa AA seqDB search
MALDYTLLKELTETPGIPGWEDRVRARVLEAVKPLVDEVRTDALGNVIAHKRGRGPRVML
AAHMDEIGFYVRHVDARGFLRLQPAGGFDARNLFARQVVVHAREGDLVGVLNPGGRPIHL
STPEERKKVPEIREFFVDLGLPADEVQARVRVGDPVTLRQETLDLGRVLTGKAMDDRASV
FLLIEALKALAGKTPAYDVYAVFTTQEEVGLRGAVTSAYGVEPEIGIALDVTLAVDTPGA
PEEEAVTRLGEGVGIKVMDGASISDRRLVTTFVDLAEKKKIPYQMEVLPLGGTDAGAIQR
ARAGVPAITLSIPTRYIHTVTETVHKADLEAGVNLLVAYLLGEA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggattacacgctcttgaaggaactcaccgaaaccccggggattcccggttgg
gaggaccgggtgcgcgcgcgggtgctggaggcggtcaagcccttggtggacgaggtgcgc
accgacgcgctcgggaacgtgatcgcgcacaagcgcggccgaggcccgcgggtgatgctc
gcagcgcacatggacgagatcgggttctacgtgcgccacgtggacgcgcgggggttcctg
cgcttgcagcccgccggggggttcgacgcgcggaacctgttcgcccgccaggtggtggtg
cacgcccgtgagggggatttggtgggcgtgctgaaccctggggggcggccaatccacctc
tccaccccggaggagcgcaagaaggtccccgagatccgggagtttttcgtggacctcggt
ttgcccgcggacgaggtgcaggcccgggtgcgcgtgggggacccggtcacgctgcgccag
gagaccctggatttgggccgggtcctgaccgggaaggccatggacgaccgcgcgagcgtc
ttcctgttgatcgaggccctcaaggccctcgccgggaagaccccggcttacgacgtgtac
gcggtcttcaccacgcaggaggaggttggcctccgaggcgcggtgaccagcgcgtacggg
gtggagcccgagatcgggatcgccctggacgtgaccctcgcggtggacacccccggcgcg
ccggaggaggaggccgtgacccggctcggggaaggcgtgggcatcaaggtcatggacggg
gcctcgatcagcgaccggcggctcgtcacgaccttcgtggacctcgcggagaagaagaag
atcccctaccagatggaggtcctgcccctgggcggcaccgacgcaggcgcgatccagcgg
gcgcgcgcgggcgtgcctgcgatcacgctctccatccccacgcggtacatccacaccgtg
accgagacggtgcacaaggcggacctcgaggcgggcgtgaacctcctcgtcgcgtacctg
ctgggcgaagcgtaa

DBGET integrated database retrieval system