KEGG   Marinithermus hydrothermalis: Marky_0198Help
Entry
Marky_0198        CDS       T01457                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marky_0198
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Marky_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
198877..199911
Genome map
AA seq 344 aa AA seqDB search
MALDYTLLKELTETPGIPGWEDRVRARVLEAVKPLVDEVRTDALGNVIAHKRGRGPRVML
AAHMDEIGFYVRHVDARGFLRLQPAGGFDARNLFARQVVVHAREGDLVGVLNPGGRPIHL
STPEERKKVPEIREFFVDLGLPADEVQARVRVGDPVTLRQETLDLGRVLTGKAMDDRASV
FLLIEALKALAGKTPAYDVYAVFTTQEEVGLRGAVTSAYGVEPEIGIALDVTLAVDTPGA
PEEEAVTRLGEGVGIKVMDGASISDRRLVTTFVDLAEKKKIPYQMEVLPLGGTDAGAIQR
ARAGVPAITLSIPTRYIHTVTETVHKADLEAGVNLLVAYLLGEA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggattacacgctcttgaaggaactcaccgaaaccccggggattcccggttgg
gaggaccgggtgcgcgcgcgggtgctggaggcggtcaagcccttggtggacgaggtgcgc
accgacgcgctcgggaacgtgatcgcgcacaagcgcggccgaggcccgcgggtgatgctc
gcagcgcacatggacgagatcgggttctacgtgcgccacgtggacgcgcgggggttcctg
cgcttgcagcccgccggggggttcgacgcgcggaacctgttcgcccgccaggtggtggtg
cacgcccgtgagggggatttggtgggcgtgctgaaccctggggggcggccaatccacctc
tccaccccggaggagcgcaagaaggtccccgagatccgggagtttttcgtggacctcggt
ttgcccgcggacgaggtgcaggcccgggtgcgcgtgggggacccggtcacgctgcgccag
gagaccctggatttgggccgggtcctgaccgggaaggccatggacgaccgcgcgagcgtc
ttcctgttgatcgaggccctcaaggccctcgccgggaagaccccggcttacgacgtgtac
gcggtcttcaccacgcaggaggaggttggcctccgaggcgcggtgaccagcgcgtacggg
gtggagcccgagatcgggatcgccctggacgtgaccctcgcggtggacacccccggcgcg
ccggaggaggaggccgtgacccggctcggggaaggcgtgggcatcaaggtcatggacggg
gcctcgatcagcgaccggcggctcgtcacgaccttcgtggacctcgcggagaagaagaag
atcccctaccagatggaggtcctgcccctgggcggcaccgacgcaggcgcgatccagcgg
gcgcgcgcgggcgtgcctgcgatcacgctctccatccccacgcggtacatccacaccgtg
accgagacggtgcacaaggcggacctcgaggcgggcgtgaacctcctcgtcgcgtacctg
ctgggcgaagcgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system