KEGG   Marinithermus hydrothermalis: Marky_0215Help
Entry
Marky_0215        CDS       T01457                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mhd  Marinithermus hydrothermalis
Brite
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Marky_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(212360..213085)
Genome map
AA seq 241 aa AA seqDB search
MPGVLVLHGFTSHPERTMGPLPERLRAAGFTVAQPALRGHGTRPEDLAGVRWEDWLEDAR
AAYATLPEPRAVVGLSMGGLLAAWIAAEGEARALVALAPALGFANPLAPLAPYLAPLIPR
FPGPDSIRDPERKRRNPNYPYFPTRAFVELLELARATPARLAEVWCAALVVEAGHDRVVP
ARAVRRYHALLGSTHKEHVRFPESGHDLLLDLEDERVAAFVTDWLVRVLAPTPPSPPERV
D
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgcccggcgtactcgtactgcacggcttcacctcgcaccccgagcgcaccatgggcccc
ctacccgagcggcttcgcgccgcggggttcaccgtcgcccagcccgccctaagaggacac
ggcacgcgccccgaggacctcgcgggagtgcgctgggaggactggctcgaggacgcccgg
gcggcgtacgcgacgctgcccgaaccccgcgcggtcgtggggctgagcatgggggggttg
ctcgcagcctggatcgcggcagagggcgaggcccgggccctcgtggccctcgcgcccgcg
ctgggtttcgcgaaccccctcgcgcccctcgcgccctacctcgccccgctcatcccgcgc
ttccccggcccggactcgatccgggaccccgaacgtaagcgccgcaaccctaactacccg
tacttccccacccgcgccttcgtcgagctcctcgagctcgcccgggccacgcccgcccgc
ctggcagaggtctggtgcgcggcgctcgtggtggaggccgggcacgaccgtgtcgtaccc
gctcgggcggtgcggcgctaccacgccctgctcggcagcacgcacaaggagcacgtgcgc
ttccccgaaagcgggcatgaccttttgctggacctcgaggacgagcgggtggcggccttc
gtcacggactggctggttcgggtgctcgcccccaccccgcccagcccgcccgagcgcgta
gactaa

DBGET integrated database retrieval system