KEGG   Marinithermus hydrothermalis: Marky_0221Help
Entry
Marky_0221        CDS       T01457                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mhd00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216891..217727
Genome map
AA seq 278 aa AA seqDB search
METLAHAKVNLGLSVLGRRPDGYHELHTLFATVSVADRVALEPRPDGIRLEVRGRSLPTG
SANLAYRAAQAYLEAAGHPGGVRIVLEKHLPIAAGLGGGSADAAAVLRGLAALYPAGVAL
EPIARALGADVPFLLRGGLAEGRGVGERLVWLEPLEAHLVLVNPGVPVAAAEAYRHLRPE
EWGEALPVAAVRAALLAGEAPPYFNSLEAPVFRRYPEVARLKAALVRRGLRGVLMSGSGS
TVFGLARDAEEARWFAARLEADFPGFWVRAARLVVPSP
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggagaccctagcccacgccaaggtcaacctggggctcagcgtccttggccgccggccg
gacgggtaccacgagctgcacaccctcttcgccacggtcagcgtcgcggaccgggtcgcc
ctcgagccccgccccgacggcatccgcctcgaggtgcgcggccggtccctccccacgggc
tctgcgaacctcgcctaccgcgcggcccaggcctacctcgaggccgccgggcacccgggc
ggcgtgcggatcgtgctggaaaaacacctcccgatcgcggcggggcttgggggcggctcg
gcggacgccgcggcggtgctccggggccttgcggcgctgtacccggcgggggtggccctc
gagccaatcgcgcgcgcgctcggcgcggacgtgcccttcctcctccggggcgggctcgcc
gaggggcgcggggtgggggagcggcttgtgtggctcgagcccttggaggcgcacctcgtc
ctcgtgaaccccggggtgccggtggccgcggcggaggcgtaccgtcacctgcggccggag
gagtggggggaggccctaccggtcgcggcggtgcgggcggcgcttctggctggggaggcg
cccccgtacttcaacagcctcgaggcccccgtcttccggcgctacccggaggtggcccgc
ttgaaggccgcgcttgtacggcggggcttgcggggcgtgttgatgagcggctcgggctcg
acggtcttcggattggcccgggacgcggaggaggcccggtggttcgcggcgcggctcgag
gcggacttcccagggttctgggtgcgcgcggcgcggcttgtggtgcccagcccgtaa

DBGET integrated database retrieval system