KEGG   Marinithermus hydrothermalis: Marky_0231Help
Entry
Marky_0231        CDS       T01457                                 

Definition
(RefSeq) Agmatinase (EC:3.5.3.11)
  KO
K01480  
agmatinase [EC:3.5.3.11]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Marky_0231
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Marky_0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(225156..226073)
Genome map
AA seq 305 aa AA seqDB search
MRHTELPFTGPATFLKAPHKPLTETWEADVGFLGLPYDFGVGYRPGARFAPNALREASGR
YAPGPEGYYDPETNAHRLQGARLVDAGDVDPAQLEYAETFRRITEAARALRGRVRLPVFV
GGDHTITYPVLRAYDDLEELYVVQIDAHLDYTDARNGTRYANSSPFRRAVEAVPGLKHIT
VVGLRGLRASREAFEAARARGHTLVFARQVKADLEATLQRLPRGKRVYLSFDIDALDPAL
APGTGSPEVEGLTYGEAMRVVAHVIAHNELVGLDLTELAPNLDPTGRTALVGARLLAEAV
ALWWG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacaccgagctgcccttcaccggaccggccaccttcctcaaagccccccacaag
ccgctcaccgaaacctgggaggccgacgtggggtttttaggcttgccgtacgacttcggg
gtggggtaccgtcccggcgcgcgcttcgcgccgaacgccctccgggaagcttcgggacgg
tacgcgcccggccctgaagggtactacgacccggaaaccaacgcgcaccgcctccaaggc
gcgcgcctcgtggacgcgggggacgtggaccccgcgcagctcgagtacgcggagaccttc
cgccgcatcaccgaggccgcccgcgccttgcgcggccgcgtgcggctcccggtcttcgta
gggggggaccacacgatcacctaccccgtgctgcgggcctacgacgacctggaggagctg
tacgtggtgcagatcgacgcgcacctcgattacaccgacgcccggaacggcacgcgctac
gcgaactcctccccgttccgccgcgcggtcgaggcggtccccggcctcaagcacatcacc
gtggtgggcctccgggggttgcgcgcgagtcgcgaggccttcgaggccgcccgggcccgc
gggcacacgctcgtcttcgcccgccaggtcaaagcggacctcgaggccacccttcagcgc
ctcccgcgcggcaagcgggtctacctcagcttcgatatcgacgcgctcgaccccgccctc
gctccaggcacggggagccccgaggtggagggcctcacctacggggaggcgatgcgggtc
gtggcgcacgtaatcgcgcacaacgagctggtggggctcgaccttaccgagctcgccccg
aacctggaccccacgggccgcaccgccctcgtgggggcgcggctgctcgccgaagccgtg
gcgctctggtgggggtaa

DBGET integrated database retrieval system