KEGG   Marinithermus hydrothermalis: Marky_0290Help
Entry
Marky_0290        CDS       T01457                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Marky_0290
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Marky_0290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
282939..283427
Genome map
AA seq 162 aa AA seqDB search
MTRTAYVALGSNLGDRAGYLLAALSALGRTENIRLARLSRVYETAPVGPSGQGPYLNLVA
EIETRLEPQPLLQTLLGIERRLGRVRRERWGPRTIDLDLLLYADVVLDAEALTLPHPRLH
ERAFVLAPLCDLIPDAVHPRLGRTYRALLEAVGRVGVRVWRP
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgaaccgcgtacgtcgccctcggctccaacctcggggaccgcgccgggtacctg
ctcgccgcgcttagcgcgctcggccggaccgaaaacatccggcttgcccggctctcccgc
gtctacgagaccgcccccgtaggcccaagcggtcaggggccctacctgaacctggtggcc
gagatcgagacccgcctcgagccccaacccctcctccagaccctgctcgggatcgagcgc
cgcctgggccgggtacgccgcgagcggtgggggcctcgcacgatcgacctggacctgctg
ctgtacgcggacgtggtgctggacgcggaggcgctcaccctgccgcacccgcgcctgcac
gagcgggccttcgtcctcgcgcccctgtgtgacctgatcccggacgcggtgcacccccgg
ctggggcgcacctaccgggcgttgctcgaggcggtagggcgggtgggcgtgcgggtgtgg
cggccctaa

DBGET integrated database retrieval system