KEGG   Marinithermus hydrothermalis: Marky_0292Help
Entry
Marky_0292        CDS       T01457                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mhd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(283777..284604)
Genome map
AA seq 275 aa AA seqDB search
MVLELREHALDLTRVRLMGVLNVTPDSFSDGGRYLTVEAALLQARRMIAEGADLIDLGGE
STRPGAQPVPVEEEKRRVLPLLEALLELGVPISVDTRKPEVAQAALELGAHLLNDVTGLR
DARMLELAARYRVPVVIMHMPVPDPQTMMQHAHYDDVVAEVKAFLARQAARAIEAGVPQV
VLDPGIGFGKRLEHNLELIRRLDELAALGHPVLLGASRKRMIGELTGVEAPAERVLGTVA
AHLYGAARGAHILRVHDVRAHREALAVWEALEGGR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
gtggttctcgagcttcgcgagcacgccctcgacctcacgcgcgttcgcctcatgggagtg
ctgaacgtcaccccggactccttctccgacggcgggcggtacctcacggtggaggccgcc
ctcctccaggcccgccggatgatcgcggaaggcgcggacctgatcgacctgggcggcgag
tccacccgccccggcgcccaaccggtgccggtcgaggaggagaagcgccgggtgctcccg
ctcctagaagccctcctcgagctcggggtccccatcagcgtcgacacccgcaagcccgag
gtggctcaggcagcgctcgagctgggcgcgcacctcctcaacgacgtgaccggcctgcgc
gacgcgcgcatgctcgagctcgccgcgcggtaccgggtgcccgtggtgatcatgcacatg
cccgtaccggacccccaaacgatgatgcagcacgcccactacgacgacgtggtcgccgag
gtcaaggccttcctcgctcgccaagccgcgcgggccatcgaggcgggcgtccctcaggtg
gtgctcgacccggggatcgggttcggcaagcgcctcgagcacaacctcgagctgatccgc
cgcttggacgagctcgcggccctggggcacccggtcctgctcggcgcgagccggaaacgc
atgatcggggagctcacgggcgtcgaagccccagccgagcgcgtcctgggcacggtcgcg
gcgcacctttacggcgcggcgcgcggggcgcatatcctccgggtgcacgacgtgcgggcg
caccgcgaggccctcgcggtctgggaagcgctcgagggggggcggtga

DBGET integrated database retrieval system