KEGG   Marinithermus hydrothermalis: Marky_0330Help
Entry
Marky_0330        CDS       T01457                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mhd  Marinithermus hydrothermalis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(321670..322725)
Genome map
AA seq 351 aa AA seqDB search
MKLELDLAFLERLLGAIGPTGFEDEAARVWCAQAETFADRVERDAHGNAYAQINPGGTPR
LMLAGHIDEIGVIVTHIDDDGYVYFQGLGGWDPQVLVGQRLRFLGPQGSVLGVVGRKPIH
LLEAAEREKAVKIDELWADIGAKDGAEARAHLEVGAVGVIAQPLERLLGRRVASKAIDNR
IGAFAVLEALRYLKAAGVAAEVTAVATVQEEIGAYGARTAAYRLRPDTALVVDVTFCSRQ
PGVDKKKWGEAPLGSGANLAVGPFVHPKVLRRLRELAEREKVPYTLAAHWRFSGTDADEI
ALVREGVPSAVVSIPNRYMHSPSEVVDLGDVEAVVRLLALYAQAPVTDLVR
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctcgagctggaccttgccttcctggagcggctcctcggagccatcggccctacc
ggcttcgaggacgaggccgcccgggtctggtgcgctcaggccgagaccttcgccgaccgg
gtggagcgggatgcgcacgggaacgcctacgcccagatcaaccctggcggcaccccgcgc
ctcatgctcgccgggcacatcgatgagatcggcgtgatcgtcacgcacatcgacgacgac
gggtacgtctacttccaagggcttggcggctgggacccccaggtcctcgtcggccagcgc
ctccgcttcctcggcccccagggcagcgtgctgggcgtcgtggggcgcaagcccatccac
ctcctcgaggcggccgagcgcgaaaaagcggtcaagatcgacgagttatgggcggacatc
ggcgcaaaggacggggcggaggcccgcgcgcacctcgaggtcggcgcggtcggcgtgatc
gcgcagcccctggaacgcctcctgggtcgccgcgtcgcctcgaaggccatcgataaccgc
atcggggccttcgcggtcctcgaagcgctccgttacctgaaggcggccggggtggcggcc
gaggtcaccgcggtggccacggtccaggaggagatcggagcgtacggggcgcgcaccgcg
gcttatcgcctgcggccggacaccgcgctcgtggtggacgtgaccttctgcagccggcag
ccgggggtggacaagaagaagtggggggaggcccccctcggctccggcgcgaacctcgca
gtgggaccgttcgtgcatcccaaggtgctccggcggcttcgggagctcgcggagcgggag
aaggtgccgtacacgctcgcggcacactggcgctttagcggcacggacgcggacgagatc
gctctggtgcgcgagggcgtgccctccgcggtcgtctcgatccccaaccggtacatgcac
tccccgtccgaagtggtggacctcggggacgtggaggccgtggtacgcctgctggccctg
tacgcgcaagcgcccgttacggacctcgttcgctaa

DBGET integrated database retrieval system