KEGG   Marinithermus hydrothermalis: Marky_0650Help
Entry
Marky_0650        CDS       T01457                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Marky_0650
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Marky_0650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(629887..630816)
Genome map
AA seq 309 aa AA seqDB search
MRFFVVGDVSVDLIYFLDRIPEAGEEVPAKRALMKPGGAGATIAANLASLGHKVFLAARV
GKDSFSDLALSRIKQTGVELKHLQEDAEHTTSSVLIFVVSGGERSMVSHPGANRYLDASE
FRPRSLDQIDGLVVSAYALAGGPQREYAVKALNAAKKRNIPIFADLGSGAVRIAGKELLE
YLKGVDYLLMNQHELLTLTGASSISEGVQALHAYELQRVIVKVGPLGSIVVTPEEQELVE
PYPVEGVVDSTGAGDAYTAAFAHAILEGHDLLTAARMANIAGALVTTAVGAQGRLITRED
LETPLHAAK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgcggtttttcgtagtgggcgacgtctcggtggatcttatctatttcttggatcgaatc
ccggaagcgggggaggaggtccctgccaaacgcgcactcatgaaacccggcggggccggc
gcgaccatcgccgcgaacctcgccagcttagggcacaaggtgttcttagcggcacgcgtc
ggcaaagattcattcagcgacctggccctctcgaggatcaaacaaaccggggtcgagctc
aagcaccttcaggaggacgcggagcacaccacctcctccgtgctgatcttcgtggtctcg
ggcggggagcgctccatggtctcgcaccccggtgcaaaccggtacctggacgcctccgag
ttccggccgcgctccctggatcagatcgacggcctggtcgtctccgcgtacgccctcgcg
ggcggtccccaacgcgagtacgccgtaaaggcccttaacgccgctaaaaaacgcaacatc
cccatcttcgcggacctcggtagcggcgcggtccgcatcgcgggcaaggagctcttagag
tacctcaaaggcgtggactacctcttgatgaaccagcacgagctcctcaccctgaccggc
gcgagctccatcagcgaaggcgtgcaggccctacacgcctacgaactacaacgcgtcatc
gtcaaggtcggccccctcggctcgatcgtcgtcacaccggaggagcaggagctcgtcgaa
ccgtaccccgtggaaggcgtggtggactcgaccggcgcaggcgacgcgtacaccgcggcg
ttcgcccacgcgatcctcgaaggccacgacctcctcaccgcggcccgcatggcgaacatc
gccggagccctagtcacgaccgccgtgggcgctcaaggccggctcatcacccgcgaggac
ctcgagaccccccttcacgccgcgaagtaa

DBGET integrated database retrieval system