KEGG   Marinithermus hydrothermalis: Marky_0660Help
Entry
Marky_0660        CDS       T01457                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Marky_0660
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Marky_0660
Exosome [BR:mhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Marky_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(637704..639191)
Genome map
AA seq 495 aa AA seqDB search
MPYILALDQGTTSSRAIVFDLHGRPVAQAQREFTQHYPRPGWVEHDPVEIWETQLATARQ
ALEQAGISAQEVAALGITNQRETTLLWERSTGRPVANAIVWQDRRTAPICGALKVQGLEP
TVRAKTGLVLDPYFSGTKLRWLLEQHPNLKARAASGELAFGTVDSWLIWNLTGGRVHATD
VTNAARTLLFNIHTLSWDPELLEALEIPAALLPEVRPSAGRFGETDPALFGAAIPITGVA
GDQQAALFGQACVEPGLAKNTYGTGAFVVMHTGAQAVTGDGVLTTLAWQLEGHPPAYALE
GSIFIAGAAVQWLRDGLGIIERSAEVEALARSVPDAGGVYFVPALVGLGAPHWDPYARGL
LIGLTRGTTKAHIARAALEAIAYQTADAIRAMEAASGLRLKELRVDGGAAANDLLLEFQA
DLLNAAVLRPKVTETTALGAAYLAAVGAGMLSVPEVQARWALERRFEPRMDPARREALYA
GWRRAVERARGWSSA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatattctcgccctcgaccaggggacgacctcgagccgcgccatcgtgttcgac
ctgcacggccggcccgtcgcccaagcgcagcgggagttcacccagcactacccgcgccct
ggatgggtggagcacgaccccgtggagatctgggagacccagctggccaccgctcgccaa
gccctggagcaggccgggatctcggcccaggaggtagcagccctcgggatcacgaaccag
cgcgagaccaccctcctctgggagcgcagcacgggccggccggtcgcgaacgcgatcgtc
tggcaggaccgccgcaccgcccccatctgcggggccctcaaggtccagggcctcgagcct
acggtccgcgccaagaccgggctcgtgctcgacccgtacttctccggcaccaagctgcgc
tggctcctcgagcagcaccctaacctcaaggcccgagccgcgtcaggcgagctggccttc
ggcaccgtggacagctggctcatctggaacctgaccggcggccgggtccacgccaccgac
gtgaccaacgccgcgcgcaccctgctcttcaacatccacaccctctcctgggacccggag
ctcctcgaggccctcgagatccccgccgccctcctccccgaggtgcggccctccgcgggg
cgcttcggggagacggacccagcccttttcggcgcagccatccccatcacgggcgtggcc
ggggaccagcaggcggccctgttcggccaggcctgcgtggagccgggcctggcgaagaac
acctacggcacgggcgccttcgtcgtgatgcacaccggcgcgcaggccgtgacgggggac
ggggtgctcaccaccctcgcctggcagctcgaaggccacccccccgcgtacgccctcgag
ggctcgatcttcatcgcgggagccgcggtgcagtggcttcgggacgggctggggatcatc
gagcgctccgcggaggtcgaggccctggcgcgctcggtccccgacgcgggcggggtgtac
ttcgtgcccgccctggtggggctgggcgcgccccactgggacccgtacgcccgcggcctc
ctgatcggcctaacccgcggcaccaccaaggcccacatcgcccgcgcggccctcgaggcg
atcgcgtaccaaaccgcggacgccatccgcgcgatggaggccgcctccggcctccgactc
aaggagctgcgcgtggacgggggcgcggcggccaacgacctcctcctcgagttccaagcg
gacctgttgaacgcggcggtgctgcgccccaaggtgacggagaccaccgccttgggcgcg
gcgtacctcgccgcggtgggggccgggatgctcagcgttccggaggttcaggcgcggtgg
gccctcgagcgccgcttcgagccccggatggaccccgcccggcgcgaggcgctctacgcg
ggctggcggcgcgcggttgagcgggcccgcgggtggagttcggcatga

DBGET integrated database retrieval system