KEGG   Marinithermus hydrothermalis: Marky_0685Help
Entry
Marky_0685        CDS       T01457                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marky_0685
Enzymes [BR:mhd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Marky_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663415..665160
Genome map
AA seq 581 aa AA seqDB search
MAWDLSTLQERMRARLAFLYGAREAGAAWEAIAKRVAAFRDRHPEWLEQAPGLYADHTDV
LLITYGDQIRTPGEAPLRTLKAFMDAHLKDRVSGLHLLPHYPYSSDDGFSVIDYRRVNPE
LGTWADVEALARAYRLMLDAVINHISAQSPWFQAYRRGEAPYVHYFIELDPGTDTSTVYR
PREHPLLTPFETTRGTRYVWTTFSTDQVDLNYKNPAVLVEVLDVLLEYAAHGADLLRLDA
VGLLWKELGTSCLHLPQTHAVVKLIRDLLNATAPHVMLVPEINGPFEENLPYLGDGYDEA
QMIYNFTLPPLVLHAFYTGEATRLARWLEGVQLPSNQTAFFNFLASHDGIGVRPVEPLLP
PEEFQLLIERTLEHGGRVNYRRGPDGERRPYELCITYYDALTAPDESLDTGVARFRAAHA
ILLALAGVPGVYVHSLFGTPNWHEGYARTRQGRTLNRRKFTRAELEAALARPEGRFARVF
HEITRLLEARRAEPAFHPTALQRVLHLHPNVLALERTARAGYRLYALVNVSAHPVALSLE
GLRGGEVREVLTGTRYPIREGRLEVRLEPYGVRWLRELGTL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcctgggacctatccaccctgcaagaacggatgcgcgcgcggctggccttcctgtac
ggcgcccgggaggccggggcggcctgggaggcgatcgcgaagcgggtcgcggcgtttcgc
gatcggcacccggagtggctcgagcaagcccctggcctgtacgctgaccacaccgacgtc
ctcctcatcacctacggcgaccaaatccggacgccgggagaggccccgttgcggacgctg
aaggccttcatggacgcgcacttaaaggaccgggtctctgggctgcacctgttgccgcac
tacccgtactcctccgacgacgggttcagcgtgatcgattaccggcgcgtgaaccccgag
ctggggacctgggcggacgtggaggccctcgcccgcgcgtaccgcttgatgctggacgcg
gtgatcaaccacatctccgcgcaaagcccgtggttccaagcctaccggcgcggggaggcc
ccgtacgtgcactacttcatcgagctggatccgggcacggacacctccacggtctaccgg
ccgcgggaacaccccctcctcacgcccttcgagaccacgcggggcacgcggtacgtctgg
actaccttctctaccgaccaggtcgacctcaactacaagaaccccgcggtcctcgtggag
gtgctcgacgtgctgctcgagtacgccgcgcacggggcggacctcctgaggctcgacgcg
gtcggcctactctggaaggagctcggcacctcctgcctgcacctcccccagacgcacgcg
gtggtcaagctgatccgcgacctcctgaacgccaccgccccgcacgtgatgctcgtccca
gagatcaacggacccttcgaggaaaacctcccgtacctcggggacgggtacgacgaggcg
cagatgatttacaacttcaccctgcctcccctggtgctgcacgccttctacaccggggaa
gcgacgcgcctcgcccgctggctcgagggcgtgcagctgccctcgaaccagacggccttc
ttcaacttcctggcctcccatgacgggatcggcgtccgaccggtcgagccgttgctgccc
cccgaggagttccagctcctcatcgagcggaccctcgagcacggcggccgggtcaattac
cgccggggccccgacggggagcggcggccctatgagctgtgcatcacgtactacgacgcc
ctcaccgccccggacgaatcgctggataccggcgtggcccgcttccgcgcggcgcacgcg
atcctcctcgccctggctggcgtcccgggggtgtacgtgcactcgttgttcggcaccccg
aactggcacgaggggtacgcgcgcacgcggcagggccgcaccctaaaccgccggaagttc
acccgcgccgagctcgaggccgccctcgcgcgcccagagggccggttcgcccgcgtgttt
cacgagatcacccggttgctcgaggcccgccgggccgagcccgccttccaccccaccgcg
ctgcagcgcgtgctccacctgcacccgaacgtgctggccctggagcgcaccgcccgcgcg
gggtaccggctctacgcgttggtgaacgtctccgcgcaccccgtcgccctcagcctcgag
gggctgcgtgggggggaggtgcgggaggtgcttaccgggacgcggtacccgatccgggaa
gggcggctcgaggtgcggctcgagccctacggggtgcggtggttgcgggagctgggtacg
ctataa

DBGET integrated database retrieval system