KEGG   Marinithermus hydrothermalis: Marky_0730Help
Entry
Marky_0730        CDS       T01457                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Marky_0730
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Marky_0730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
705201..705812
Genome map
AA seq 203 aa AA seqDB search
MERKRIELEDTGLSFETEMDLERLRVLAREWIELIGEDPEREGLERTPERVAKAWAYLTR
GYRQTLEEVVNGAVFAAEGSEMVVVKGIEFYSLCEHHLLPFYGKVHVGYIPNGKILGLSK
FARITEMYARRLQVQERLALQIAQAIEAVLKPQGVGVVVEGVHLCMMMRGVEKQHSATTT
SAMLGVFRENAKTREEFLSLVRT
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtaagcggatcgagcttgaggataccgggctttccttcgagaccgagatggac
ttggagcgcttgcgcgtgctggcgcgggaatggatcgagctaatcggtgaggacccggag
cgggaggggcttgagcgaaccccggaacgcgtcgcgaaggcttgggcctacctcacccgc
gggtaccggcagaccctcgaggaggtcgtcaacggcgcggtcttcgccgcggaaggttcg
gagatggtggtggttaagggcatcgagttctactccttgtgcgagcaccacctcctgccc
ttttacggaaaggtgcacgtggggtacatcccgaacgggaagatcctggggctatccaag
ttcgctcgcatcaccgagatgtacgcccgacgcctccaggtgcaggaacgcctcgccctc
cagatcgcgcaggccattgaggcagtcctcaagcctcagggagtcggcgtggtggtggag
ggggtgcacctgtgcatgatgatgcgcggggtggagaagcagcactccgcaaccacgacg
agcgccatgctaggggtatttcgggagaacgccaagacgcgggaagagttcctcagcctg
gtgcgtacgtga

DBGET integrated database retrieval system