KEGG   Marinithermus hydrothermalis: Marky_0836Help
Entry
Marky_0836        CDS       T01457                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mhd  Marinithermus hydrothermalis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Marky_0836
DNA repair and recombination proteins [BR:mhd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Marky_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
809151..809744
Genome map
AA seq 197 aa AA seqDB search
MKYPNALLQLVRSLARLPGVGPKSAQKLALYLAQHAEAAETLEQALRGVRERVRPCVRCG
NLAEAELCPVCADPGRDHGVICVVETPGDLLAIEKSGEYNGVYHVLGGALNPLEGIGPED
LRVAELLERLEGVQEVILATSMTVEGEATAGYLAELLKARGLRATRPAYGLPVGGALEYV
DEVTLARALAHRRAFSE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtacccgaacgcgctgttgcagctggtgcgtagcctcgcccgcctgccgggcgta
gggcccaagagcgcgcagaagctggccttgtacctagcccagcacgccgaggcggccgag
acgctcgagcaggccctccggggcgtacgggaacgggtgcgcccgtgcgtgcgctgcggt
aacctcgccgaggcggagttgtgccccgtgtgtgcggatcccggccgggaccacggggtg
atctgcgtggtggagacgccgggggacctcctcgcgatcgagaagagcggggagtacaac
ggagtctaccacgttctcgggggggcgctgaacccgctggaggggatcgggccggaggac
ctccgagtggcggagctgcttgaacgacttgagggcgtccaggaggtgatcctggcgacc
tcgatgacggtcgagggagaggcgaccgcgggctacctcgccgaactgctcaaagcccgc
ggcctccgcgcgacccggccggcctacggcctgcctgtgggcggcgcgctcgagtacgtg
gatgaggtgaccctcgctcgagctttagcgcaccggcgtgccttctcggagtga

DBGET integrated database retrieval system