KEGG   Marinithermus hydrothermalis: Marky_0850Help
Entry
Marky_0850        CDS       T01457                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_0850
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Marky_0850
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Marky_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
818819..819727
Genome map
AA seq 302 aa AA seqDB search
MGTMNKVGVLGVPMDLGAGRRGVDMGPSAIRYAQLHTALRQLGYAVLDYGDVEVPVVETL
SRKNGRSPGGLHHLQAIRQACEETVQSLKKMPEDTFPIVLGGDHSISMGSITGASRGERI
GVIWVDAHGDFNTPETSPSGNIHGMPLAALCGFGDPQLVNIGWEGAKVRPEDVVLIGIRE
LDPGEKLLLREAGVTVYTMKEVDQLGISRIAAETIERFRGLPKVHVSLDADVLDPTVAPG
VGTPVPGGLSYREAHLLMELLAEAGIVTSLDLVEVNPILDQENRTAEIMVELAASLLGKQ
IF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccatgaacaaggttggggtgttgggagttccgatggacctcggcgcggggcgg
cgcggcgtggacatgggcccgagcgcgatccgctacgcccagctgcataccgccctccgg
cagctggggtacgcggtgctggactacggggacgtggaggtcccggtggtggagaccctg
agccgtaagaacggccggagcccgggagggctgcaccacctccaagcgatccgacaggcc
tgcgaggagaccgtgcagagcctgaaaaaaatgcccgaggacaccttccccatcgtgctg
gggggggatcactcgatctccatggggtcgatcaccggcgcgagccgcggggaacgcatc
ggcgtgatctgggtggacgcccacggggacttcaacacccccgagaccagcccgagcggg
aacatccacggcatgccgctcgcggcgctgtgcggcttcggggacccgcagctcgtaaac
atcgggtgggagggggccaaggtgcgcccggaggacgtggtcctgatcgggattcgcgag
ctcgatccgggcgagaaactcctgctgcgcgaggctggcgtcaccgtctacacgatgaag
gaggtggaccagctcggcatctcccgcatcgccgccgagacgatcgagcggttccgaggc
ctgcccaaggtgcacgtctcgctggacgcggacgtcctcgacccgaccgtcgcgcccggc
gtgggcaccccggtccccggcgggctttcgtaccgcgaggcgcacttattgatggagctc
ttggcggaggccgggatcgtgaccagcctggacctggtggaggtgaaccccatcctcgac
caggaaaaccgcaccgctgagatcatggtggagctcgcggcgagcctactgggcaaacag
atcttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system