KEGG   Marinithermus hydrothermalis: Marky_0858Help
Entry
Marky_0858        CDS       T01457                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Marky_0858
Enzymes [BR:mhd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Marky_0858
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Marky_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826603..827397
Genome map
AA seq 264 aa AA seqDB search
MPELPEVETTRQALRPYLEGRAIRAIHHTDPARYRRTEDAVGRRVEVLRRRGKFLIAALE
GGLELVVHLGMTGGFRFAEGPHVRVRLEVPDRPLYFNDPRRFGRWWVVPAGAYREIPLLD
RLGPEPLSDAFTLEGFREGLARTARGVKAVLLAQEVVAGLGNIYADEALWRAGVHPARPA
NTLEVGAIARLYTAIREVLAEAVAAGGSTLQDGTYRRPDGALGRFQVQHKVYGRPGAPCV
RCGTPILKAVVAGRGTHFCPRCQA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagctgcccgaagtcgagaccacccgccaggccctccggccctacctcgagggc
cgggcgatccgggcgattcaccacacggaccccgcgcgttaccgccgaaccgaggatgcg
gtagggcggcgcgtcgaggtcctgagacggcggggcaagttcttgatcgccgccctcgag
ggcggtctggagctggtcgtgcaccttggcatgacgggcgggtttcgtttcgcggaaggc
ccgcacgtccgggtgcggctcgaggttccggatcgtcccctgtacttcaacgatccacgg
cgttttgggcggtggtgggtggtgccggcgggcgcgtaccgcgagattccgctcctcgat
cgcctggggccggagcccttgagcgacgccttcaccctcgagggcttccgggagggactc
gcgcgcaccgctcgaggagtaaaggccgtgctgctcgcgcaagaggtcgtggcggggctt
ggaaacatctacgcagacgaggcgctctggcgggcgggggtgcatcccgcgcgtcccgcg
aacaccttggaggtcggggcgatagcgcggttgtacacggccattcgcgaggtgctcgcc
gaggcggtggctgcgggcggatcaacgctccaggacggcacgtaccggaggccggacggg
gcactggggcgctttcaggtgcagcacaaggtgtacgggcggccgggcgcgccgtgcgtg
cgctgcggcaccccgatcctgaaagcggtggtggccggacggggcacgcatttttgcccc
cgctgccaagcttga

DBGET integrated database retrieval system