KEGG   Marinithermus hydrothermalis: Marky_1000Help
Entry
Marky_1000        CDS       T01457                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_1000
  Amino acid metabolism
   00340 Histidine metabolism
    Marky_1000
Enzymes [BR:mhd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Marky_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
979187..980482
Genome map
AA seq 431 aa AA seqDB search
MRVYRAEEVRDRFRSRRLAFTVSERLKEGIARHFGEALSPEEAVRRILAEVAREGDTALD
RWSERLDGHPVEEVPKRAWREAYDDLPAALRHALDAMRERVQAFYAREPQGGFVHADADG
VLMQLVRPLERVGVYVPGGSAPLVSTVVMTVVPARVAGVEEVILATPPKPHPAILAAAWV
VGADRLFAMGGAQAIGALAYGTARVPRVDKIVGPGNLFVTLAKKEVFGTVGIDGLAGPTE
TLIVADSSADPKVLAADLLAQAEHDSLAEPWLVSPDAALLERVKAELKAQLADLPRAGIA
REALAQGGMVWVRDLEEAVELANLYAPEHLCLSVADPAALLGKVRNAGGVFLGEHSGEAL
GDYVAGPSHVMPTAGTARFQGGLSVRDFLKVIPVVGLTRDAAARLAEPGAEVARAEALEA
HARALLRRKTD
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgtatcgagcggaggaggttcgggaccggtttcgttcccggcggctcgcgttc
acggtgagcgaacgcctgaaggaaggcatcgcgcggcattttggggaggcgctctccccg
gaggaagccgtgcgccgcatcctagcggaggtggcgcgcgagggggacacggcgcttgac
cggtggagcgaacgcctggacgggcacccggtggaggaggtgcccaagcgagcctggcgc
gaggcatacgacgacctgcccgccgccttaaggcacgcccttgatgcgatgcgcgagcgg
gtgcaggccttttacgcgcgcgagccccaaggggggttcgtgcacgcggatgcggatggg
gtgttgatgcagctcgtgcgccccctggagcgggtgggggtgtacgtgcccggaggcagc
gcgccgctggtgtctacggttgtgatgaccgtggtgcccgcgcgggtcgcgggggtggag
gaggtgatcctcgccaccccgcccaagccgcaccccgcgatcctagccgcggcctgggtg
gtgggggcggaccggttgtttgccatggggggcgcgcaggcgatcggggccctggcgtac
ggcacggcgcgcgttccgcgcgtggacaagatcgtggggccgggcaacctcttcgtgacc
ctcgcgaaaaaagaggtcttcggcacggtagggatcgacggcctcgcggggcccaccgag
accctgatcgtggccgactcgagcgcggatcctaaggtgctcgcggcggacctgctcgcg
caggcggagcacgattccctcgccgagccgtggctcgtctcgccggatgcggcgcttttg
gagcgggtgaaggcggagctgaaggcgcagctcgccgacctgcccagggcggggatcgca
cgcgaagccctggcgcagggggggatggtgtgggtgcgggatttggaggaggccgtggag
ctcgctaacctgtacgcgcccgagcacctgtgcctttcggtggcggacccggcagcgctg
ttgggcaaggtacggaacgccgggggggtgttcctcggggagcactcgggggaggccctg
ggggattacgtggcggggccgagccacgtgatgcccaccgcgggcaccgcgcgcttccag
ggaggcttgagcgtgcgggacttcctcaaggtgatcccggtggtggggctcacgcgggac
gcggccgcgcggttggcggagcccggcgcggaggtggcgcgggccgaggccctcgaggcg
cacgcgcgcgcgctgttgcgacgaaagacagactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system