KEGG   Marinithermus hydrothermalis: Marky_1202Help
Entry
Marky_1202        CDS       T01457                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_1202
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marky_1202
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marky_1202
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marky_1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1185496..1186722
Genome map
AA seq 408 aa AA seqDB search
MPVLPDYPLPDARGRFGVYGGRYVPETLIPALEELEAAYREAKADPEFLKALEYYRTRYA
GRPTPLYFAANLTRHWGGARVYLKREDLNHTGAHKINNTLGQALLARRMGKRRVIAETGA
GQHGVSVATVAALFGLECVVYMGEEDVRRQALNVFRMELLGAEVHPVASGSRTLKDATNE
AIRDWVTHVRDSFYILGSVVGPHPYPMIVRDFQSVIGEEVKRQLLEAEGRAVPDAVVACV
GGGSNAIGIFAPFAYLPEGRPRLVGVEAAGKGLGTGRHAASINAGKRGVLHGSYMYLLCD
ADGQIQPAHSVSAGLDYPGVGPEHAYYADAGIAEYGSVTDAEALEAFQLLARLEGIVPAL
ESAHAVAYAGRLAREMRPDEVLVVNLSGRGDKDVVEVKRLLEARKGGR
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtgttaccggactaccccttacccgacgcccgtggccgtttcggcgtgtacggc
gggcgttatgtgcccgagaccctgattccagccctcgaggagctcgaggcggcctaccga
gaggcgaaggcggacccggagttcctcaaggccctcgagtattaccgcacccgctacgcg
gggcgccccacgccgctgtacttcgcggcgaacctcacccggcactgggggggcgcgcgg
gtgtacctgaagcgcgaggacctgaaccataccggcgcgcacaagatcaacaacacccta
ggccaggcgctgctcgcgcggcgcatggggaaacgccgggtgatcgcggagaccggcgcg
gggcagcacggtgtgtcggtggcgacggtcgcggcgctgtttggcctggagtgcgtcgtg
tacatgggcgaggaggacgtgcgccggcaggccttgaacgtcttccggatggagcttcta
ggggcggaggtgcaccccgtggcgagcgggagtcgcacgcttaaggacgcgaccaacgag
gcgattcgcgactgggtgacgcacgtgcgggactccttctacatcctgggctccgtggtg
gggccgcacccgtaccccatgatcgtgcgggattttcagagcgtgatcggggaagaggtg
aagcggcagctcctcgaggccgagggccgcgcggtcccggacgcggtggtggcttgcgtt
gggggcggatcgaacgcgatcggaatcttcgcgccattcgcgtacctgccggaggggcgg
ccgcgcctggtgggcgtggaggccgcggggaaggggctcggcaccggccggcacgccgcc
tcgatcaacgcgggcaagcggggcgtgctgcacgggagctacatgtacctgttgtgtgat
gcggacgggcagatccagccggcacactcggtctccgcggggctggactacccgggggtg
ggcccggagcacgcctactacgcggacgcggggatcgccgagtacgggagcgtcacggac
gcggaggccctcgaggccttccagctgctcgcgcggctcgaggggatcgtgccggccttg
gagtcggcgcacgcggtggcgtacgcgggccggctcgcgcgggagatgcggccggacgag
gtgctcgtggtgaatctctccgggcgcggggacaaggacgttgtcgaggtgaagcgcctg
ctcgaggcgcggaagggagggcggtga

DBGET integrated database retrieval system