KEGG   Marinithermus hydrothermalis: Marky_1203Help
Entry
Marky_1203        CDS       T01457                                 

Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_1203
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Marky_1203
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Marky_1203
Enzymes [BR:mhd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Marky_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1186725..1187507
Genome map
AA seq 260 aa AA seqDB search
MSERVAEAFRAARAEGRRAVIPYLTAGYPSPEAFVEVATRLARRADLLEVGLPYSDPLGD
GPTIQRASEQALRQGVRTAAVLEMVRALRERTRVPILLMTYVNPVLAWGGARFFEAFAGA
GVDGVILPDLPPDEDPALVAAARRAGLATVFLLAPTSTEARIQTVVRHTSGFVYAVSVTG
VTGARARLPEEVGALVRRIKAHTELPVAVGFGVSNEATARQAAAAADGVVVGSALVRALE
AGEDPLTVLEAVRRGAAKPV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgtcggagcgggtggcggaggcgtttcgcgccgcgcgcgccgaggggcgccgggcggtg
atcccgtacctgaccgcggggtaccccagcccggaggcgttcgtggaggtggcgacccgg
ctggcccgccgggcggacctgttggaggtgggcctgccgtactcggaccctttaggggat
gggcccacgatccagcgggcgagcgagcaggccttgcggcagggggtgcggaccgcggcg
gtgctggagatggtgcgcgccttgcgggaacgcacccgggtgcccatcctcctgatgact
tacgtgaacccggtactggcctgggggggcgcgcggtttttcgaggccttcgccggggcg
ggcgtggacggggtgatcctgccggacctgccgccggacgaggaccctgcgctcgtggcc
gcggcgcgccgggcggggctcgccacggtctttttactcgcgccgacctcgacggaagcg
cggatccagaccgtggtgcgccacacgagtgggtttgtgtatgccgtctccgtgaccggg
gtgactggggcgcgcgcgcggcttccggaggaggtgggggcgctggtgcgtcgcatcaag
gcccacaccgaactgcccgtggccgtggggttcggggtatcgaacgaggccaccgcgcgg
caggcggcggccgcagcggacggcgtggtggtgggcagcgcgctggtgcgggccctcgag
gcgggggaggatcccctcacggtgctcgaggcggtgcggcggggagcggcaaagccggta
tag

DBGET integrated database retrieval system