KEGG   Marinithermus hydrothermalis: Marky_1209Help
Entry
Marky_1209        CDS       T01457                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Marky_1209
   01230 Biosynthesis of amino acids
    Marky_1209
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Marky_1209
   00051 Fructose and mannose metabolism
    Marky_1209
   00562 Inositol phosphate metabolism
    Marky_1209
Enzymes [BR:mhd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Marky_1209
Exosome [BR:mhd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Marky_1209
  Exosomal proteins of bladder cancer cells
   Marky_1209
  Exosomal proteins of melanoma cells
   Marky_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1193761..1194516)
Genome map
AA seq 251 aa AA seqDB search
MTRRVLIAGNWKMHKTTAEARAWCRAVLDGLPDPVACEVAVLPAYPLLPVVREALENSPV
RWGAQDVSAHEEGAYTGEVAARQLADLGCAYVVVGHSERRAYWKESNALVAAKARKALEH
GLVPIVCVGEPLEVREAGEAVAFTLAQLEGSLEGVEAPDPGRLVVAYEPVWAIGTGRTAT
PEDAQEMARAIRDWLARRYTPEFAAGVRVLYGGSIKPGNFAEILEGPDVDGGLVGGASLD
ATRFLALATAV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcggcgggtgctcattgccgggaactggaagatgcacaagacgaccgccgaggca
cgggcgtggtgccgggcggtcctcgacggcttaccggacccggtggcgtgcgaggtggcc
gtgctgcccgcctaccccctcctccccgttgttcgggaagcgcttgaaaacagcccggtg
cggtggggagcccaggacgtctcggcgcacgaggaaggggcctatactggcgaggtcgcc
gcgcgtcagctcgcggatctggggtgcgcgtacgtcgtggtggggcacagcgagcgccgg
gcgtactggaaggagtccaacgctctcgtcgcggctaaggcccgcaaggccctcgagcac
ggcctggtgccgatcgtgtgcgtgggggaacctctcgaggtgcgcgaggcgggagaggcg
gtggctttcacgctagcgcagctcgaggggagtctggagggggtggaggccccggatccc
ggtcggctggtcgtggcctacgaaccggtgtgggcgatcggcaccgggcgaaccgcgacc
ccggaggacgcccaggagatggcgcgggcgatccgggactggctggcccgccggtacacg
ccggagttcgccgcgggggtgcgcgtgctgtacgggggttcgatcaagcctgggaacttt
gcggagatcttggagggtccggacgtggacggcgggctggtaggcggcgcgagcctggat
gcgacgcggtttttggcgctggctacggctgtgtag

DBGET integrated database retrieval system